Recombinant Shigella flexneri serotype 5b UPF0442 protein yjjB (yjjB)

Shipped with Ice Packs
In Stock

Description

Role in Shigella flexneri

While yjjB’s exact functional role remains uncharacterized, UPF0442 family proteins are implicated in bacterial stress responses and metabolic regulation. Shigella flexneri serotype 5b is a predominant cause of shigellosis, responsible for 60% of global cases . Recombinant yjjB aids in studying antigenic profiles for vaccine development, particularly against diarrheal diseases .

Pathogenesis and Immune Response

Though not directly linked to virulence factors like IpaB/C/D (invasion plasmid antigens) or YfiBNR system components , yjjB’s recombinant form enables epitope mapping and antibody production for diagnostic or therapeutic tools .

Expression and Purification

  • Cloning: The yjjB gene (UniProt ID: Q0SX48) is codon-optimized for E. coli expression .

  • Purification: Affinity chromatography (His-tag) followed by gel filtration ensures high purity .

Applications in Research

  1. Vaccine Development: Antigenicity studies to design subunit vaccines against shigellosis .

  2. Antibody Production: Generating polyclonal/monoclonal antibodies for diagnostic kits .

  3. Structural Studies: Analyzing conformational epitopes via X-ray crystallography or cryo-EM .

Comparative Analysis with Related Proteins

ProteinFunctionApplicationSource
yjjBUncharacterized (UPF0442 family)Vaccine antigenS. flexneri
YfiBRegulates c-di-GMP levelsVirulence mechanism studies S. flexneri
IpaBHost cell invasionVaccine target S. flexneri

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
yjjB; SFV_4394; UPF0442 protein YjjB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
yjjB
Target Protein Sequence
MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISSVKISQLGYSEP LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
Uniprot No.

Target Background

Database Links

KEGG: sfv:SFV_4394

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What strain considerations are important when working with Shigella flexneri serotype 5b UPF0442 protein yjjB?

When conducting research with Shigella flexneri serotype 5b UPF0442 protein yjjB, several strain-related factors require careful consideration:

  • Genome-sequenced strains: For genetic manipulations and protein expression studies, it is strongly recommended to use fully sequenced strains. Strain 8401 of Shigella flexneri serotype 5b is commonly used for yjjB studies as its genome has been completely sequenced .

  • Virulence plasmid stability: Shigella's virulence plasmid can be lost during repeated passage or growth at temperatures above 35°C . If virulence factors are important for your research, cultivation should include monitoring using Congo red binding phenotype (CR+), which indicates the presence of the virulence plasmid.

  • Growth conditions optimization: Shigella flexneri grows optimally at 37°C in rich medium with aeration. The pH should be maintained near neutral (6.8-7.4) . When expressing recombinant yjjB, these conditions should be adapted for the expression host system.

  • Media selection: Different research objectives may require specific media:

    • Rich media (TSB/LB) for general cultivation

    • Rich defined medium (EZ-RDM) for reproducible experiments requiring controlled conditions

    • Minimal media with appropriate supplements for nutritional studies

What are the recommended storage conditions for purified recombinant yjjB protein?

For optimal stability and activity preservation of recombinant Shigella flexneri yjjB protein, the following storage parameters are recommended:

  • Short-term storage: Store in a Tris-based buffer with 50% glycerol at -20°C .

  • Long-term storage: For extended preservation, store at -80°C in single-use aliquots to prevent repeated freeze-thaw cycles .

  • Working solutions: Prepare small aliquots and store at 4°C for up to one week to maintain protein integrity during active experimentation .

  • Reconstitution guidelines: When using lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a final concentration to enhance stability .

  • Quality monitoring: Before each experimental use, verify protein integrity using size-exclusion chromatography or SDS-PAGE to confirm the absence of degradation or aggregation.

How does the expression of yjjB protein vary across different Shigella flexneri serotypes, and what implications does this have for vaccine development?

The expression profile of yjjB protein varies among Shigella flexneri serotypes, creating significant implications for vaccine development strategies. While detailed expression data across all serotypes is limited in current literature, several important considerations emerge:

Shigella flexneri encompasses 15 serotypes, with serotype 2a being the most prevalent globally, followed by 3a and 6 . Expression variations of yjjB across these serotypes arise from:

  • Genomic diversity: Shigella flexneri contains numerous insertion sequences, phage genome remnants, and genomic islands that vary between isolates . While coding sequences may remain conserved, regulatory flanking sequences can differ substantially, affecting expression levels.

  • Serotype-specific adaptation: Different serotypes have adapted to specific ecological niches, potentially leading to differential expression of membrane proteins like yjjB to meet environmental demands.

For vaccine development, these variations create critical challenges:

  • Cross-protection limitations: If yjjB serves as a vaccine antigen, sequence variations across serotypes may restrict cross-protection. Effective vaccines would need to target conserved epitopes or include variants from multiple serotypes.

  • Expression-level considerations: Serotypes expressing higher levels of yjjB might elicit stronger immune responses or demonstrate increased susceptibility to yjjB-targeted interventions.

  • Combination strategies: Given serotype diversity challenges, successful Shigella vaccines might require combining multiple antigens, potentially including yjjB alongside traditional antigens like O-antigens or IpaD .

Systematic comparative analysis of yjjB expression, structure, and immunogenicity across serotypes would significantly advance targeted vaccine approaches against this pathogen.

What are the challenges in developing functional assays for recombinant yjjB protein, and how can they be overcome?

Developing reliable functional assays for Shigella flexneri serotype 5b UPF0442 protein yjjB presents several technical challenges due to its uncharacterized nature. These challenges and their methodological solutions include:

ChallengeMethodological SolutionKey Considerations
Unknown physiological functionEmploy comparative genomics and structural predictionBegin with multiple preliminary assay types (transport, signaling, protein interactions)
Membrane protein solubility issuesSystematic detergent screeningTest maltoside (DDM), glucoside (OG), neopentyl glycol (LMNG) and steroid-based detergents at various concentrations
Native conformation preservationReconstitution into liposomes or nanodiscsVerify structural integrity using circular dichroism
Lack of known binding partnersPerform pull-down assays and proximity labelingUtilize unbiased screening approaches before developing targeted assays
Reproducibility challengesCompare different expression systemsEstablish standardized quality control metrics including SEC profiles

A comprehensive approach should include:

  • Initial bioinformatic analysis to predict potential functions

  • Development of parallel assay formats testing multiple hypothesized functions

  • Systematic screening for conditions that maintain native protein conformation

  • Identification of interaction partners through unbiased screening

  • Validation using site-directed mutagenesis to confirm structure-function relationships

This structured methodology provides the best opportunity to develop meaningful functional assays despite the limited characterization of yjjB protein.

How can researchers effectively address Shigella flexneri serotype diversity when studying yjjB for therapeutic applications?

Addressing Shigella flexneri serotype diversity represents a critical challenge when investigating yjjB for therapeutic applications. With 15 distinct serotypes documented and serotype-specific protection being a major obstacle , researchers should implement the following methodological framework:

  • Comprehensive sequence analysis:

    • Perform exhaustive sequence alignment of yjjB from all available Shigella flexneri serotypes

    • Identify and prioritize conserved regions as universal therapeutic targets

    • Quantify sequence variation to predict cross-serotype effectiveness potential

  • Structural-functional mapping:

    • Determine three-dimensional structure using X-ray crystallography or cryo-EM

    • Identify conserved structural pockets that could serve as binding sites

    • Design therapeutics targeting these conserved structural features rather than sequence-specific elements

  • Multi-serotype testing platform:

    • Develop a standardized panel representing all major serotypes

    • Establish clear efficacy thresholds across multiple serotypes for advancement

    • Implement iterative optimization based on broad-spectrum performance

  • Epitope conservation analysis for vaccine applications:

    • Map B-cell and T-cell epitopes within the yjjB protein

    • Assess epitope conservation across serotypes using computational prediction tools

    • Focus development on highly conserved immunogenic regions

  • Combinatorial approaches:

    • Engineer chimeric constructs containing elements from multiple serotypes

    • Develop antibody mixtures recognizing diverse serotype variants

    • Create multi-epitope vaccine candidates addressing serotype variations

This systematic approach maximizes the potential for developing therapeutic strategies with cross-serotype effectiveness, addressing a fundamental challenge in Shigella intervention development.

What are the optimal conditions for expressing and purifying functional recombinant Shigella flexneri serotype 5b UPF0442 protein yjjB?

Optimizing expression and purification of functional recombinant Shigella flexneri serotype 5b UPF0442 protein yjjB requires careful consideration of multiple parameters to maintain its native structure and function. Based on available data and membrane protein biochemistry principles, the following protocol is recommended:

Expression System Selection

While multiple expression systems are viable , E. coli remains preferred for initial trials due to:

  • Genetic relatedness to Shigella

  • Cost-effectiveness and rapid growth

  • Availability of specialized membrane protein expression strains (C41/C43)

Expression Protocol Optimization

  • Vector design:

    • Include a removable affinity tag (6-10xHis) for purification

    • Consider fusion partners (SUMO, MBP) to enhance solubility

    • Use tightly regulated promoters with tunability

  • Growth condition parameters:

    • Temperature: 16-25°C after induction improves membrane protein folding

    • Media: Rich defined medium (EZ-RDM) ensures reproducibility

    • Induction: Low inducer concentrations with gradual induction improves folding

  • Membrane preparation:

    • Gentle cell disruption methods (French press or sonication)

    • Membrane isolation via ultracentrifugation

    • Systematic detergent screening for optimal solubilization

Detergent Screening Protocol

DetergentWorking ConcentrationCMC (mM)Application StageNotes
DDM0.5-1.0%0.17Extraction & PurificationGentle, maintains activity
LMNG0.01-0.05%0.01Purification & StorageHigh stability, low CMC
GDN0.01-0.05%0.01Crystallization attemptsGood for structural studies
Digitonin0.1-0.5%0.5Complex preservationVery mild for protein complexes

Purification Strategy

  • Initial capture:

    • IMAC using Ni-NTA with detergent above CMC

    • Include glycerol (10-20%) for stability

    • Gradual imidazole gradient to minimize contaminants

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Optional ion exchange step if higher purity required

  • Quality assessment:

    • SDS-PAGE (target >90% purity)

    • Western blot confirmation

    • Circular dichroism to verify secondary structure

    • Thermal stability assays to confirm proper folding

This systematic approach should be iteratively optimized based on initial results to identify conditions yielding maximum amounts of functionally active yjjB protein.

What experimental approaches are most effective for studying the potential role of yjjB in Shigella pathogenesis?

Investigating the potential role of yjjB in Shigella pathogenesis requires a multi-faceted experimental approach combining genetic, biochemical, and infection model studies. The following methodological framework provides comprehensive strategies:

Genetic Manipulation Approaches

  • Gene Deletion and Complementation:

    • Generate clean yjjB deletion mutant using allelic exchange

    • Create complementation strains with native and inducible promoters

    • Develop point mutants targeting key functional residues

  • Expression Analysis:

    • Monitor yjjB expression under infection-relevant conditions

    • Utilize reporter fusions to track expression dynamics during infection

    • Perform qRT-PCR to quantify expression changes in various microenvironments

Cellular Phenotype Characterization

  • Membrane Integrity Studies:

    • Compare membrane potential and permeability between wild-type and ΔyjjB strains

    • Measure sensitivity to membrane-disrupting agents

    • Evaluate potential transport functions using fluorescent substrates

  • Virulence Phenotype Assessment:

    • Quantify epithelial cell invasion efficiency

    • Measure intracellular survival and replication rates

    • Assess cell-to-cell spread capabilities using plaque assays

Infection Model Studies

Model SystemApplicationsMeasurementsAdvantagesLimitations
Polarized epithelial monolayersInvasion, transcytosisTEER, bacterial countsPhysiological barrierLimited complexity
Human intestinal organoidsHost-pathogen interactionCytokine response, tissue damage3D architectureTechnical complexity
Guinea pig keratoconjunctivitisIn vivo pathogenesisClinical scoring, tissue responseEstablished modelLimited to ocular infection
Mouse pulmonary infectionSystemic disseminationBacterial burden, inflammatory markersImmune response analysisNot natural route

Molecular Interaction Studies

  • Protein-Protein Interaction Analysis:

    • Bacterial two-hybrid screening for interaction partners

    • Co-immunoprecipitation with candidate partners

    • Proximity labeling approaches to identify in vivo interactions

  • Host-Pathogen Interaction:

    • Binding assays with host factors

    • Surface plasmon resonance to measure interaction kinetics

    • Identification of host cell receptors or targets

This comprehensive experimental framework allows for systematic investigation of yjjB's role in Shigella pathogenesis from multiple complementary angles, providing robust evidence regarding its function in bacterial virulence.

How can researchers effectively design experiments to investigate potential interactions between yjjB and other Shigella virulence factors?

Investigating interactions between yjjB and other Shigella virulence factors requires a systematic experimental design that combines genetic, biochemical, and functional approaches. The following methodological framework provides a comprehensive strategy:

Genetic Interaction Mapping

Double Mutant Analysis:

  • Generate a matrix of double mutants combining ΔyjjB with mutations in key virulence factors

  • Analyze for synthetic phenotypes (enhanced or suppressed virulence)

  • Quantify genetic interactions using epistasis scoring methods

  • Focus initially on virulence plasmid-encoded factors identified through Congo red binding phenotypes

Transcriptional Profiling:

  • Compare transcriptomes of wild-type, ΔyjjB, and virulence factor mutants

  • Identify gene expression patterns suggesting functional relationships

  • Perform clustering analysis to identify co-regulated genes

Protein-Protein Interaction Analysis

Systematic Interaction Screening Protocol:

TechniqueApplicationSensitivityBiological ContextCritical Controls
Bacterial two-hybridInitial screeningMediumHeterologousEmpty vector, unrelated protein pairs
Co-immunoprecipitationValidationHighNative conditionsTag-only pulldown, irrelevant protein
BioID/APEX2Proximity mappingHighIn vivoUnfused enzyme, subcellular markers
Cross-linking MSInteraction interfaceVery highNativeNon-crosslinked samples

Structural Validation:

  • Use hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Perform mutagenesis of predicted interface residues

  • Validate functional consequences of disrupting interactions

Functional Cooperation Analysis

Virulence Phenotype Assessment:

  • Compare invasion efficiency between single and double mutants

  • Measure intracellular survival and replication rates

  • Quantify cell-to-cell spread using plaque assays

  • Evaluate inflammatory response induction

Secretion System Interaction:

  • Investigate if yjjB affects Type III Secretion System (T3SS) assembly or function

  • Monitor secretion of effector proteins in yjjB mutants

  • Test for direct interactions with T3SS components

Data Integration Framework

To effectively interpret results from these diverse approaches:

  • Implement a weighted scoring system based on method reliability

  • Construct an interaction network diagram with confidence levels

  • Map interactions to known virulence pathways

  • Identify novel pathways suggested by the interaction data

  • Prioritize interactions for functional validation based on evidence strength

This comprehensive approach provides multiple lines of evidence to characterize yjjB's relationship with established Shigella virulence factors, building a mechanistic understanding of its potential contributions to pathogenesis.

What methods are most appropriate for evaluating the immunogenicity and vaccine potential of recombinant Shigella flexneri serotype 5b UPF0442 protein yjjB?

Evaluating the immunogenicity and vaccine potential of recombinant Shigella flexneri serotype 5b UPF0442 protein yjjB requires a systematic approach progressing from computational analysis through preclinical testing. The following comprehensive methodology provides a structured framework:

In Silico Analysis and Antigen Design

  • Epitope Prediction:

    • Identify potential B-cell and T-cell epitopes using computational algorithms

    • Assess epitope conservation across Shigella serotypes

    • Evaluate potential cross-reactivity with human proteins

  • Structural Analysis:

    • Model three-dimensional structure using homology modeling

    • Identify surface-exposed regions likely to elicit antibody responses

    • Predict conformational epitopes using structural bioinformatics

Antigen Preparation Optimization

  • Expression Strategy:

    • Compare full-length protein versus epitope-rich fragments

    • Evaluate different expression systems (E. coli, yeast, baculovirus)

    • Optimize purification to ensure native conformation

  • Formulation Development:

    • Screen adjuvant combinations for optimal immune stimulation

    • Assess stability in different formulation buffers

    • Develop stability-indicating assays for quality control

Preclinical Immunogenicity Evaluation

Animal Model Selection Matrix:

Animal ModelApplicationsImmune ParametersAdvantagesLimitations
MouseInitial screeningSerum IgG, mucosal IgA, T-cell responsesWell-characterized immune systemLimited similarity to human infection
Guinea pigProtective efficacyProtection against keratoconjunctivitisPermits Serény testLimited immunological reagents
Non-human primatesTranslational validationComprehensive immune profilingPhysiologically relevantEthical considerations, high cost

Immunization Protocol Design:

  • Conduct dose-ranging studies to determine optimal antigen concentration

  • Compare prime-boost strategies to enhance immune responses

  • Evaluate multiple administration routes (parenteral vs. mucosal)

  • Test adjuvant combinations to optimize response quality

Immune Response Assessment:

  • Measure systemic antibody titers using ELISA and functional assays

  • Quantify mucosal antibody production in relevant tissues

  • Characterize T-cell responses using ELISpot and flow cytometry

  • Assess memory B and T cell generation for long-term protection

Protective Efficacy Evaluation

  • Challenge Models:

    • Guinea pig Serény test (keratoconjunctivitis model)

    • Mouse pulmonary infection model

    • Passive protection studies using immune sera

  • Correlates of Protection:

    • Analyze correlation between immune parameters and protection

    • Perform antibody transfer experiments to confirm protective components

    • Identify minimum protective antibody titers

Comparative Vaccine Approaches

  • Antigen Presentation Strategies:

    • Evaluate recombinant protein alone vs. conjugate approaches

    • Test live attenuated vectors expressing yjjB

    • Compare with O-antigen conjugates used in existing Shigella vaccine candidates

  • Combination Assessment:

    • Test yjjB with other Shigella antigens (IpaD, IpaB)

    • Evaluate synergistic adjuvant combinations

    • Develop multivalent formulations addressing serotype diversity

This systematic approach provides a comprehensive framework for evaluating the immunogenicity and vaccine potential of recombinant Shigella flexneri serotype 5b UPF0442 protein yjjB, integrating computational prediction, in vitro characterization, and in vivo validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.