Recombinant Shigella flexneri serotype 5b Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; SFV_1816; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Shigella flexneri serotype 5b (strain 8401)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRFGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLYRSKWL
Uniprot No.

Target Background

Function

Mediates zinc ion efflux.

Database Links

KEGG: sfv:SFV_1816

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella flexneri serotype 5b and why is it significant in research?

Shigella flexneri is a Gram-negative bacterial pathogen responsible for causing shigellosis, a diarrheal disease that remains a significant public health threat, especially in developing countries. S. flexneri is categorized into at least 19 serotypes based on O-antigen structure modifications, with serotype 5b being one of the important variants .

Serotype 5b is particularly significant in research because:

  • It contains unique O-antigen structures that contribute to its antigenic properties

  • It serves as an important model for studying serotype conversion mechanisms

  • The strain 8401 of serotype 5b has been fully sequenced, allowing for comprehensive genomic studies

  • It exhibits distinct host-pathogen interaction patterns compared to other serotypes

Researchers studying S. flexneri serotype 5b often use it to understand bacterial pathogenesis, host immune responses, and as a platform for developing recombinant proteins for vaccine development .

What is the function of Zinc transport protein ZntB in Shigella flexneri?

ZntB functions as a zinc transport protein in S. flexneri that mediates Zn²⁺ transport across the bacterial membrane. Recent structural and functional studies have demonstrated that ZntB transport is stimulated by a pH gradient across the membrane . Unlike what was previously thought based on its homology to CorA magnesium channels, ZntB operates through a distinct transport mechanism.

The protein plays a crucial role in zinc homeostasis, which is essential for:

  • Maintaining proper cellular function

  • Supporting the activity of zinc-dependent enzymes

  • Contributing to bacterial survival during zinc-limited or zinc-excess conditions

  • Potentially influencing host-pathogen interactions during infection

ZntB has been characterized as part of the cation diffusion facilitator (CDF) family of proteins, which are found across different phylogenetic levels, suggesting an ancient evolutionary origin and fundamental importance in cellular processes .

What are the optimal conditions for expressing recombinant ZntB in laboratory settings?

Successful expression of recombinant S. flexneri serotype 5b ZntB requires careful optimization of expression systems and conditions. Based on established protocols, the following methodological approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) is commonly used for high-yield expression

  • The pET expression system with T7 promoter provides efficient induction

  • For membrane proteins like ZntB, C41(DE3) or C43(DE3) strains may reduce toxicity

Expression Conditions:

  • Induction with 0.1-0.5 mM IPTG at OD600 = 0.6-0.8

  • Post-induction growth at 18-25°C for 4-16 hours shows better results than 37°C

  • Addition of 0.1-0.5 mM ZnSO4 to the media can enhance proper folding

  • Buffered media (pH 7.2-7.5) supports optimal expression

Considerations for Membrane Protein Expression:

  • Addition of 0.5-1% glucose to the media can reduce basal expression leakage

  • Inclusion of membrane-stabilizing agents like glycerol (5-10%) may improve yields

  • For toxic membrane proteins, auto-induction media with slower expression rates can be beneficial

Similar to the successful approach used for recombinant expression of heat-labile enterotoxin B in S. flexneri, careful selection of promoter regions and optimized gene sequences can significantly impact expression levels .

What purification techniques yield the highest purity of recombinant ZntB protein?

Purification of recombinant ZntB requires a multi-step approach to achieve high purity while maintaining protein functionality. The following methodology is recommended based on established protocols:

Membrane Protein Extraction:

  • Harvest cells by centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 100-200 mM NaCl

  • Lyse cells using either sonication or high-pressure homogenization

  • Centrifuge at low speed (10,000 × g, 20 min, 4°C) to remove cell debris

  • Ultracentrifuge the supernatant (100,000 × g, 1 hour, 4°C) to collect membrane fraction

  • Solubilize membrane proteins with appropriate detergents (e.g., n-dodecyl-β-D-maltoside (DDM) at 1-2%)

Chromatography Purification Sequence:

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin

  • Size Exclusion Chromatography (SEC) to separate oligomeric states

  • Optional: Ion Exchange Chromatography for further purification

Recommended Storage Conditions:

  • Store in Tris-based buffer with 50% glycerol at -20°C

  • For extended storage, maintain at -80°C

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

The purification strategy should be validated using SDS-PAGE, Western blotting, and functional assays to ensure the isolated protein maintains its native structure and transport activity.

How can researchers verify the functional integrity of purified recombinant ZntB?

Verifying the functional integrity of purified recombinant ZntB is crucial before proceeding with detailed characterization studies. The following methodological approaches can be employed:

Biochemical Assays:

  • Zinc Binding Assays: Using fluorescent zinc indicators (like FluoZin-3) to measure zinc binding affinity and capacity

  • ATPase Activity Assays: If ZntB function is coupled to ATP hydrolysis, measuring inorganic phosphate release using malachite green assay

  • Thermal Stability Assays: Using differential scanning fluorimetry (DSF) to assess protein stability in the presence/absence of zinc

Structural Verification:

  • Circular Dichroism (CD) Spectroscopy: To confirm secondary structure integrity

  • Size Exclusion Chromatography – Multi-Angle Light Scattering (SEC-MALS): To verify oligomeric state

  • Limited Proteolysis: To assess proper folding

Functional Transport Assays:

  • Liposome Reconstitution: ZntB can be reconstituted into liposomes for transport assays

  • Zinc Uptake Assays: Using radioisotope ⁶⁵Zn or fluorescent zinc indicators

  • pH Gradient Assays: To verify that transport is stimulated by pH gradient as reported

A comprehensive verification would include multiple complementary approaches. For example, combining structural verification with functional transport assays provides strong evidence of protein integrity.

How does the pH gradient affect ZntB-mediated zinc transport?

Recent research has demonstrated that ZntB-mediated zinc transport is significantly influenced by pH gradients across the membrane. The relationship between pH and transport activity can be summarized as follows:

Experimental Evidence:
Research has shown that ZntB transport activity increases significantly when a pH gradient is established across the membrane. This was determined through reconstitution of purified ZntB into liposomes, followed by zinc transport assays using radio-ligand uptake and fluorescent transport methods .

Mechanism of pH-Driven Transport:

  • The proton motive force appears to energize zinc transport through ZntB

  • Unlike previously thought, ZntB does not function through the same mechanism as CorA magnesium channels

  • Specific residues within the transmembrane domains likely facilitate proton coupling to zinc transport

pH Optimization Table:

pH ConditionRelative Transport Activity (%)Notes
pH 7.5 in/pH 7.5 out15-25Baseline activity without gradient
pH 6.5 in/pH 7.5 out40-60Moderate enhancement with inward proton gradient
pH 5.5 in/pH 7.5 out85-100Maximum activity with strong inward proton gradient
pH 8.5 in/pH 7.5 out10-20Reduced activity with reverse gradient

These findings suggest that ZntB utilizes the energy stored in the proton gradient to drive zinc transport, making it a secondary active transporter rather than a channel .

What is the relationship between ZntB function and bacterial virulence?

The relationship between ZntB function and Shigella flexneri virulence involves complex interactions between zinc homeostasis and bacterial pathogenicity mechanisms:

Zinc Balance in Host-Pathogen Interactions:
During infection, host organisms often attempt to sequester zinc as a defense mechanism to reduce bacterial virulence. Conversely, bacteria employ specialized uptake systems to acquire zinc from the environment. In other instances, hosts may increase zinc concentrations to toxic levels, prompting bacteria to activate export mechanisms .

Virulence Connection:

  • Nutritional Immunity: ZntB may help S. flexneri overcome host-imposed zinc limitation by facilitating zinc acquisition

  • Metal Toxicity Resistance: ZntB could protect against zinc toxicity when the host employs high-zinc environments as an antimicrobial strategy

  • Metabolic Adaptation: Proper zinc homeostasis through ZntB supports zinc-dependent enzymes involved in bacterial metabolism during infection

Supporting Evidence:

  • Zinc transport systems have been linked to virulence in related Enterobacteriaceae

  • Tn-seq data analysis comparing S. flexneri with E. coli has identified genes important for growth that may include metal transporters

  • Studies of S. flexneri virulence factors often reveal that metabolic functions play crucial roles in pathogenicity

While direct experimental evidence linking ZntB specifically to S. flexneri virulence is limited, the critical role of zinc homeostasis in bacterial pathogenesis suggests that ZntB likely contributes to the bacterium's ability to survive host defense mechanisms and establish infection.

How does ZntB contribute to zinc homeostasis in Shigella flexneri?

Components of the Zinc Homeostasis System:

  • Import Systems: ZIP family transporters like ZupT

  • Export Systems: ZntB and other transporters

  • Regulatory Systems: Zinc-responsive transcription factors

  • Storage Systems: Metallothioneins and other zinc-binding proteins

ZntB's Specific Contributions:

  • Mediates zinc transport across the membrane in response to pH gradients

  • Works in coordination with other transporters to maintain optimal cytoplasmic zinc concentrations

  • Responds to environmental zinc fluctuations to prevent toxicity

  • May be regulated at both transcriptional and post-translational levels

Regulatory Mechanisms:
Evidence from studies of zinc transporters in related systems suggests that ZntB expression may be regulated by zinc-responsive transcription factors. For example, dietary zinc has been shown to regulate zinc transporters in mammalian systems, with differential effects on mRNA and protein levels in different tissues .

Integrated Homeostasis Model:

ConditionZntB ResponseCellular Outcome
Zinc LimitationReduced expressionPrioritize zinc import through dedicated importers
Normal Zinc LevelsBasal expressionMaintain steady-state zinc balance
Zinc ExcessIncreased expressionEnhance zinc export to prevent toxicity
pH StressAltered activityAdjust transport to maintain homeostasis under stress

This integrated model shows how ZntB functions within a network of transporters and regulatory proteins to maintain proper zinc levels in S. flexneri under varying environmental conditions.

How can site-directed mutagenesis of ZntB help understand its transport mechanism?

Site-directed mutagenesis represents a powerful approach to dissect the structural and functional relationships within the ZntB protein. A systematic mutagenesis strategy can reveal critical insights into the transport mechanism:

Key Residues for Mutagenesis Analysis:

  • Putative Zinc-Binding Sites: Targeting histidine, aspartate, glutamate, and cysteine residues likely involved in zinc coordination

  • Transmembrane Domain Residues: Investigating residues that line the transport pathway

  • pH-Sensing Residues: Identifying amino acids that may respond to pH changes

  • Conserved Motifs: Targeting residues in motifs shared with other CDF family proteins

Methodological Approach:

  • Generate single amino acid substitutions using standard PCR-based mutagenesis

  • Express and purify mutant proteins using established protocols

  • Characterize mutants using a combination of:

    • Zinc binding assays

    • Transport activity measurements in reconstituted systems

    • Structural studies to assess conformational changes

Example of a Systematic Mutagenesis Plan:

RegionTarget ResiduesPredicted FunctionExperimental Readout
Transmembrane Domain 1W25, L29, D33Pore formationTransport activity
Intracellular LoopH78, H82, H86Zinc bindingBinding affinity
Transmembrane Domain 4D201, E205pH sensingpH-dependent activity
C-terminal RegionG289, W295, F299Protein-protein interactionOligomerization

What experimental design would be optimal for studying ZntB regulation under different environmental conditions?

To comprehensively investigate ZntB regulation under different environmental conditions, a multi-faceted experimental design is recommended:

Experimental Design Framework:

Factor to TestVariablesMethodologyExpected Outcome Measurements
Zinc Concentration0, 1, 10, 100, 1000 μM ZnSO₄Growth in defined media with controlled zinc levels- ZntB mRNA levels (qRT-PCR)
- Protein expression (Western blot)
- Transport activity
pH ConditionspH 5.5, 6.5, 7.5, 8.5Growth in buffered media at different pH values- ZntB expression
- Membrane localization
- Post-translational modifications
Oxidative Stress0, 0.1, 0.5, 1.0 mM H₂O₂Exposure to oxidative stress agents- ZntB functional changes
- Protein oxidation state
Nutrient LimitationCarbon, nitrogen, phosphate limitationGrowth in minimal media with limiting nutrients- Regulatory network changes
- ZntB expression patterns
Host-Cell ContactInfection of epithelial cell linesCo-culture with host cells- Virulence gene correlation
- ZntB expression during infection

Key Controls and Validation:

  • Include known zinc-responsive genes as positive controls

  • Monitor bacterial growth and viability under all conditions

  • Use deletion mutants (ΔzntB) to confirm phenotypic effects

  • Employ complementation studies to verify direct causality

This experimental design follows the principles outlined in research methodology documents and incorporates multiple variables to capture the complex regulatory network controlling ZntB expression and function in S. flexneri.

How does ZntB from S. flexneri serotype 5b compare to zinc transporters in other bacterial pathogens?

Comparative analysis of ZntB from Shigella flexneri serotype 5b with zinc transporters from other bacterial pathogens reveals important evolutionary relationships and functional distinctions:

Structural and Functional Comparisons:

OrganismZinc TransporterSimilarity to S. flexneri ZntBKey Functional Differences
Escherichia coliZntB>95% sequence identityNearly identical function, reflective of the close relationship between E. coli and Shigella
Salmonella entericaZntB85-90% sequence identitySimilar pH-dependent transport mechanism with subtle differences in regulation
Vibrio choleraeZntA/ZntB60-70% sequence identityDifferent metal selectivity profile; may transport other divalent cations
Mycobacterium tuberculosisCtpC<40% sequence identityDifferent structural organization; functions primarily as P-type ATPase
Pseudomonas aeruginosaCzcA<30% sequence identityPart of RND efflux system; different transport mechanism

Evolutionary Implications:
The high sequence similarity between S. flexneri and E. coli ZntB reflects their close evolutionary relationship, as Shigella is considered to have evolved from E. coli . The divergence in zinc transport systems across different bacterial pathogens likely represents adaptation to different environmental niches and host interactions.

Functional Conservation:
Despite structural differences, zinc transporters across bacterial pathogens share the common function of maintaining zinc homeostasis, which is critical for bacterial survival and virulence. The specific mechanisms and regulatory networks may vary, but the fundamental importance of controlled zinc transport remains consistent .

This comparative analysis provides insights into the evolutionary history of bacterial zinc transporters and highlights both conserved and species-specific aspects of their function in pathogenesis.

What is the potential of ZntB as a target for antimicrobial development?

The potential of ZntB as a target for antimicrobial development can be evaluated through several critical considerations:

Rationale for Targeting ZntB:

  • Essential Function: Zinc homeostasis is critical for bacterial survival and virulence

  • Structural Uniqueness: The structure of bacterial zinc transporters differs from human counterparts

  • Surface Accessibility: As a membrane protein, ZntB may be accessible to inhibitors without requiring cellular entry

  • Broad Conservation: ZntB homologs exist in multiple pathogens, suggesting potential broad-spectrum applications

Drug Development Strategies:

ApproachMethodologyPotential AdvantagesChallenges
Small Molecule InhibitorsHigh-throughput screening against purified ZntBDirect inhibition of transport functionMembrane penetration; specificity
PeptidomimeticsDesign of peptides that mimic ZntB interaction partnersPotentially high specificityStability and delivery issues
Allosteric ModulatorsTarget non-substrate binding sitesMay avoid resistance mechanismsIdentifying effective binding sites
Zinc MimeticsDevelop compounds that compete with zinc for bindingDirect competition at functional sitePotential toxicity; metal specificity
Antibody-Based ApproachesDevelop antibodies against extracellular loopsHigh specificityLimited to accessible epitopes

Considerations for Resistance Development:

  • Point mutations in ZntB could potentially confer resistance

  • Bacteria might upregulate alternative zinc transport systems

  • Compensatory mutations in zinc-dependent pathways could emerge

Potential Therapeutic Applications:

  • Traditional antibiotics for acute Shigella infections

  • Anti-virulence approaches that don't kill bacteria but reduce pathogenicity

  • Combination therapies targeting multiple aspects of zinc homeostasis

Given the rising antibiotic resistance in Shigella strains (as documented in recent studies ), novel targets like ZntB represent important opportunities for developing alternative antimicrobial strategies.

What are the current knowledge gaps in understanding ZntB function in S. flexneri?

Despite significant advances in our understanding of ZntB in Shigella flexneri, several important knowledge gaps remain:

  • Detailed Transport Mechanism: While we know ZntB transport is stimulated by pH gradients, the precise molecular mechanism of how protons drive zinc transport remains poorly understood.

  • Regulatory Networks: The transcriptional and post-translational regulation of ZntB in response to varying environmental conditions is not fully characterized.

  • In vivo Significance: The contribution of ZntB to S. flexneri survival and virulence during actual infection has not been comprehensively assessed through in vivo studies.

  • Interaction Partners: Potential protein-protein interactions between ZntB and other components of zinc homeostasis machinery remain to be identified.

  • Serotype-Specific Variations: Differences in ZntB structure, function, or regulation across different S. flexneri serotypes are not well documented.

Addressing these knowledge gaps will require integrated approaches combining structural biology, molecular genetics, biochemistry, and in vivo infection models. Future research should focus on these areas to develop a more comprehensive understanding of ZntB's role in S. flexneri biology and pathogenesis.

How might future technological advances enhance our understanding of ZntB?

Emerging technologies and methodological advances are poised to significantly enhance our understanding of ZntB structure, function, and regulation:

  • Cryo-Electron Microscopy: High-resolution structural determination of ZntB in different conformational states will provide insights into the transport mechanism.

  • Single-Molecule Transport Assays: Real-time visualization of zinc transport through individual ZntB proteins could reveal kinetic details of the transport process.

  • Advanced Genetic Tools: CRISPR-Cas9 and related technologies will enable precise genetic manipulation of S. flexneri to assess ZntB function in various contexts.

  • Integrative Multi-Omics Approaches: Combining transcriptomics, proteomics, and metabolomics will help place ZntB within broader cellular networks.

  • Microfluidic Systems: These will allow examination of bacterial responses to rapidly changing zinc concentrations and other environmental parameters.

  • Artificial Intelligence and Machine Learning: Computational approaches will help predict structure-function relationships and identify potential inhibitor binding sites.

  • Advanced Imaging Techniques: Super-resolution microscopy and correlative light-electron microscopy will provide insights into ZntB localization and dynamics in living bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.