Recombinant Shigella phage SfII Bactoprenol glucosyl transferase (gtrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer requirements.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
gtrB; bgt; Bactoprenol glucosyl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Shigella phage SfII (Shigella flexneri bacteriophage II) (Bacteriophage SfII)
Target Names
gtrB
Target Protein Sequence
MKISLVVPVFNEEEAIPVFYKTVREFQELKPYEVEIVFINDGSKDATESIINALAVSDPL VVPLSFTRNFGKEPALFAGLDHASGDAVIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRLKRKTAEWFYKLHNKISTPKIEENVGDFRLMSREVVENIKLLPERNLFMKGI LSWVGGQTDVVEYVRAERVAGISKFNGWKLWNLALEGITSFSTFPLRVWTYIGLFVASIS FLYGAWMIIDTLVFGNPVRGYPSLLVSILFLGGVQLIGIGVLGEYIGRIYIEVKNRPKYI IKKSHRGNP
Uniprot No.

Target Background

Function

Recombinant Shigella phage SfII Bactoprenol glucosyl transferase (gtrB) is involved in O antigen modification. Its enzymatic function catalyzes the transfer of a glucose residue from UDP-glucose to a lipid carrier.

Database Links

KEGG: vg:16384913

Protein Families
Glycosyltransferase 2 family, GtrB subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of gtrB in Shigella phage SfII?

SfII is a serotype-converting temperate bacteriophage of the highly prevalent Shigella flexneri serotype 2a. The complete genome of SfII is 41,475 bp with an average G+C content of 49.17%, corresponding to 58 coding sequences (CDSs) . The gtrB gene is located within the gtr locus, which typically includes three genes arranged in an operon: gtrA, gtrB, and gtrII. In serotype 2a strains, the SfII prophage carrying both the gtr locus and oacD is inserted between proA and adrA genes on the bacterial chromosome . The genes in the gtr locus are arranged as a single operon, with gtrII being the serotype-specific gene positioned downstream of gtrA and gtrB .

How does the gtr locus function in serotype conversion?

The gtr locus (gtrA, gtrB, and gtrII) plays a crucial role in O-antigen modification, which contributes to serotype conversion – a key defense mechanism used by S. flexneri to evade host defense responses . The first two genes (gtrA and gtrB) are highly conserved and interchangeable between serotypes, whereas gtrII encodes a serotype-specific glucosyltransferase responsible for the addition of a glucosyl group to a specific sugar residue in the O-unit . For serotype 2a specifically, research has shown that the SfII bacteriophage-carried rfb operon, along with bgt and gtrII, is sufficient to express the heterologous S. flexneri 2a O-antigen containing the 3,4 antigenic determinants in typhoid vaccine strain Ty21a .

What is the specific function of gtrB in this system?

The gtrB gene encodes a bactoprenol glycosyltransferase that belongs to the glycosyltransferase 2 superfamily . Based on the analysis of homologous proteins, gtrB is involved in the transfer of glucose from UDP-glucose to a lipid carrier (bactoprenol) to form a lipid-linked glucose intermediate. This intermediate is subsequently used by the serotype-specific gtrII enzyme to modify the O-antigen unit with a glucose residue . In mutation studies of related systems, disruption of gtrB prevents O-antigen modification, suggesting its essential role in the glucosylation pathway .

What expression systems are suitable for recombinant gtrB production?

Based on the nature of gtrB as a bacterial glycosyltransferase, several expression systems can be considered:

  • E. coli-based expression: Since Shigella and E. coli are closely related, using pET vector systems in E. coli BL21(DE3) or its derivatives would likely be effective for gtrB expression. Consider including a purification tag (His6, GST, or MBP) to facilitate downstream purification.

  • Cell-free expression systems: For membrane-associated proteins like glycosyltransferases, cell-free systems may provide advantages in avoiding toxicity issues potentially associated with overexpression.

  • Pseudomonas-based expression: Given that functional gtrA/B/II systems have been identified in Pseudomonas donghuensis , Pseudomonas expression hosts might provide a compatible cellular environment for proper folding and activity.

When designing expression constructs, researchers should consider incorporating the complete gtr operon or co-expressing gtrA, as these proteins often work together functionally.

How can researchers verify successful O-antigen modification by gtrB?

Multiple analytical techniques can be employed to assess O-antigen modification:

Table 1: Methods for Analyzing O-antigen Modification

MethodApplicationAdvantagesLimitations
SDS-PAGE LPS analysisVisualization of O-antigen pattern shiftsSimple, widely accessible techniqueLimited resolution for minor modifications
NMR spectroscopyStructural confirmation of glucosylationProvides detailed structural informationRequires purified LPS in sufficient quantities
Mass spectrometryDetection of mass changes in O-antigenHigh sensitivity, can detect small changesComplex data interpretation
Two-dimensional 1H, 13C HSQC NMRDifferentiation between serotypes (e.g., 2a and Y)Can detect the presence/absence of side chain glucosyl residuesRequires specialized equipment and expertise

Research has demonstrated that deletion of genes in the gtr locus results in a shift in the O-antigen band size, as observed by SDS-PAGE, indicating altered glycosylation patterns . Additionally, two-dimensional 1H, 13C heteronuclear single quantum coherence (HSQC) NMR spectroscopy has been successfully used to differentiate between serotypes 2a and Y based on the presence or absence of the side chain glucosyl residue .

What critical residues and domains are essential for gtrB function?

While the search results don't provide specific information about critical residues in gtrB itself, studies on the related gtrII protein in the same operon have identified key functional residues. In Pseudomonas donghuensis HYS, mutations E47A and K480A in gtrII abolished its function, while F430A and F431A mutations did not completely eliminate activity .

For gtrB specifically, researchers investigating structure-function relationships should consider:

  • Identifying conserved motifs across gtrB homologs from different phages and bacterial species

  • Analyzing predicted catalytic domains based on homology to other glycosyltransferases in the GT2 family

  • Performing alanine-scanning mutagenesis of conserved residues

  • Examining substrate-binding regions through molecular docking studies

The amino acid sequence homology to the glycosyltransferase 2 superfamily (especially to domains like cd04187, DPM1-like bac) can provide initial guidance for structure-function investigations .

How does gtrB interact with gtrA and gtrII in the serotype conversion process?

The functional relationship between these three proteins appears to involve a coordinated process:

  • GtrA likely functions as a flippase, based on homology to the GtrA superfamily, translocating the glucosylated lipid intermediate across the membrane

  • GtrB serves as the bactoprenol glycosyltransferase, transferring glucose to the lipid carrier

  • GtrII acts as the serotype-specific glucosyltransferase, transferring the glucose from the lipid carrier to the appropriate rhamnose of the O-antigen chain

Research in Lactobacillus johnsonii FI9785 has shown that putative bactoprenol glycosyltransferase (similar to gtrB) and flippase (similar to gtrA) proteins are essential for homopolysaccharide biosynthesis. Deletion of either gene prevented exopolysaccharide production and caused a slow-growth phenotype that could be rescued by complementation . This suggests a tight functional coupling between these proteins.

How can recombinant gtrB be utilized in glycoengineering applications?

Bactoprenol glycosyltransferases like gtrB have potential applications in:

  • Engineering novel O-antigen structures: By combining different gtrB and gtr-type genes, researchers could potentially create modified bacterial surface polysaccharides with novel properties.

  • Vaccine development: The ability to express heterologous O-antigens has been demonstrated in typhoid vaccine strain development. The SfII bacteriophage-carried rfb operon along with bgt and gtrII was sufficient to express the heterologous S. flexneri 2a O-antigen in Ty21a . Similar approaches could be used to create multivalent vaccines.

  • Glycoconjugate synthesis: The ability of gtrB to transfer sugars to lipid carriers could potentially be exploited for in vitro or in vivo synthesis of glycoconjugates.

  • Studying host-pathogen interactions: Modified O-antigens can be used to investigate how specific glycan structures affect host immune responses and bacterial survival.

What are the evolutionary implications of gtr operons in bacteriophages?

The presence of gtr operons in multiple Shigella bacteriophages suggests an important evolutionary role in bacterial adaptation. Serotype-converting bacteriophages containing gtr operons are carried on six prophages or cryptic prophages (SfI, SfIC, SfII, SfIV, SfV, and SfX) in Shigella .

This distribution suggests that:

  • Horizontal gene transfer of gtr operons mediated by bacteriophages is a key mechanism for generating serotype diversity in Shigella

  • The modular nature of the gtr system (conserved gtrA/B with variable gtr-type) allows for efficient evolution of new serotypes

  • Phage-mediated serotype conversion represents a convergent evolutionary strategy also observed in other bacterial pathogens like Salmonella

Comparative genomic analysis has revealed significant homology (30% of the genome in total) between sections of SfV (another serotype-converting phage) and the e14 and KpLE1 prophages in the E. coli K-12 genome, suggesting common evolutionary origins .

What are the main challenges in working with recombinant gtrB?

Several potential challenges researchers might encounter include:

  • Membrane association: As a bactoprenol glycosyltransferase, gtrB likely associates with membranes, which can complicate expression, purification, and activity assays.

  • Substrate availability: Studies require access to UDP-glucose and bactoprenol (or analogs), which may not be commercially available or may be expensive.

  • Functional dependence: The functional relationship between gtrA, gtrB, and gtrII may necessitate co-expression or reconstitution of the complete system to observe activity.

  • Activity assays: Developing reliable assays to measure glycosyltransferase activity can be technically challenging.

How can CRISPR-Cas9 technology be applied to study gtrB function?

CRISPR-Cas9 technology offers powerful approaches for studying gtrB function:

  • Precise gene knockout: Create clean deletions of gtrB in Shigella to study its role in O-antigen modification and serotype conversion without polar effects on other genes

  • Domain mapping: Generate targeted mutations in specific domains to identify functional regions

  • Reporter fusion: Create in-frame fusions with fluorescent proteins to study localization and expression patterns

  • CRISPRi: Use of CRISPR interference to achieve tunable repression of gtrB expression to study dosage effects

  • Base editing: Introduce specific amino acid changes to study structure-function relationships without disrupting the reading frame

When designing CRISPR strategies, researchers should consider the genomic context of the SfII prophage integration site between proA and adrA , and design guides accordingly to ensure specificity.

What emerging technologies could advance gtrB research?

Several cutting-edge approaches could significantly enhance our understanding of gtrB:

  • Cryo-EM structural studies: Determine the three-dimensional structure of gtrB alone and in complex with gtrA to understand the molecular mechanism of glucose transfer

  • Single-molecule techniques: Observe the real-time dynamics of glycosyltransferase activity using fluorescently labeled substrates

  • Systems biology approaches: Integrate transcriptomics, proteomics, and glycomics to understand how gtrB functions within the broader context of bacterial cell surface modification

  • Synthetic biology: Design minimal systems expressing only essential components for O-antigen modification to define the core machinery

  • In situ structural biology: Use techniques like cross-linking mass spectrometry to capture transient interactions between gtrB and its partners in the native membrane environment

How might gtrB research contribute to bacteriophage therapy development?

Understanding gtrB and O-antigen modification systems is crucial for bacteriophage therapy development:

  • Phage resistance mechanisms: O-antigen modification by gtr systems can affect phage recognition and infection. For example, research has shown that 3/4-O-acetylation is essential for resistance of serotype 2a strains to phage Sf6 .

  • Phage host range: The SfII phage has a unique host range compared to other Shigella phages. While SfV can infect 7 of 12 S. flexneri serotypes tested, SfII only infected 3 serotypes (3b, 5a, and Y) . Understanding the role of gtrB in these host range differences could help design better phage therapy cocktails.

  • Engineering broader host-range phages: Knowledge of how O-antigen modifications affect phage specificity could enable the engineering of phages with broader host ranges for improved therapeutic coverage.

  • Combination therapies: Novel lytic phages like Sfin-1, which shows potent activity against multidrug-resistant isolates of S. flexneri, S. dysenteriae, and S. sonnei , could potentially be used in combination with engineered phages targeting specific serotypes.

Understanding the molecular mechanisms of gtrB function will contribute to the broader goal of developing effective alternatives to antibiotics for treating Shigella infections, which have become a priority for the World Health Organization due to increasing antibiotic resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.