Recombinant Shigella phage SfII Bactoprenol-linked glucose translocase (gtrA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
gtrA; Bactoprenol-linked glucose translocase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Shigella phage SfII (Shigella flexneri bacteriophage II) (Bacteriophage SfII)
Target Names
gtrA
Target Protein Sequence
MLKLFVKYTSIGVLNTLIHWVVFGVCIYAAHTSQALANFTGFVVAVSFSFFANARFTFKA STTAMRYMYYVGFMGILSVIVGWAADKCSLPPIVTLITFSAISLVCGFVYSKFIVFRDAK
Uniprot No.

Target Background

Function
This protein is involved in O antigen modification and the translocation of bactoprenol-linked glucose across the cytoplasmic membrane.
Database Links

KEGG: vg:16384914

Protein Families
GtrA family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of gtrA in Shigella phage SfII?

The gtrA gene in Shigella phage SfII is part of a three-gene operon (gtrABC) that encodes proteins responsible for serotype conversion in Shigella flexneri. Within the SfII genome (GenBank accession no. KC736978), gtrA is located within the serotype-conversion cassette that includes gtrB and gtrII (a serotype-specific variant of gtrC). The SfII phage typically integrates into the tRNA-thrW gene of the host chromosome, which is positioned downstream of the proA gene and upstream of the yaiC gene . This genomic location is consistent with other serotype-converting phages in S. flexneri, with the exception of Sf6, which integrates at a different site. The gtrA gene specifically encodes a protein approximately 120 amino acids in length that contains multiple transmembrane domains consistent with its proposed role as a membrane-associated translocase.

How does the gtrA-encoded protein function in O-antigen modification?

The gtrA gene encodes a bactoprenol-linked glucosyltranslocase, commonly referred to as a "flippase." In the O-antigen modification process, GtrA functions as part of a three-protein system alongside GtrB and GtrC. GtrB acts as a bactoprenol glucosyltransferase that transfers glucose from UDP-glucose to bactoprenol phosphate in the cytoplasm. GtrA then translocates (or "flips") this bactoprenol-glucose complex across the cytoplasmic membrane to the periplasmic space . Once in the periplasm, the serotype-specific glycosyltransferase GtrC transfers the glucose from the bactoprenol carrier to a specific position on the O-antigen repeat unit. This modification alters the antigenic properties of the bacterial surface, contributing to serotype conversion and helping the bacterium evade host immune responses .

What is the evolutionary relationship between gtrA genes in different serotype-converting phages?

Genomic analysis indicates that gtrA is highly conserved among different serotype-converting phages of Shigella and Salmonella, suggesting strong evolutionary pressure to maintain its function. In contrast to the high variability observed in gtrC genes, gtrA exhibits approximately 80-90% sequence identity across different phages, including SfII, SfI, and SfX . This conservation likely reflects the critical and unchanging nature of its role in translocating bactoprenol-linked glucose across the membrane.

Table 1: Sequence Conservation of gtr Genes Across Selected Phages

PhagegtrA identity (%)gtrB identity (%)gtrC identity (%)Host Species
SfII100 (reference)100 (reference)100 (reference)S. flexneri
SfI878528S. flexneri
SfV848225S. flexneri
SfX898831S. flexneri
P228179<20Salmonella

The high conservation of gtrA and gtrB, contrasted with the low conservation of gtrC, supports the model that GtrA and GtrB perform similar functions across different phages, while GtrC provides serotype specificity .

What experimental approaches are most effective for studying the membrane topology and translocation mechanism of GtrA?

To effectively study GtrA's membrane topology and translocation mechanism, researchers should employ a multi-faceted approach combining structural, biochemical, and genetic methods:

  • Cysteine Scanning Mutagenesis: Systematically replace individual amino acids with cysteine residues and then probe their accessibility using membrane-impermeable sulfhydryl reagents. This approach can reveal which regions of GtrA are exposed to the cytoplasm, periplasm, or embedded within the membrane.

  • GFP-Fusion Analysis: Creating truncated GtrA-GFP fusion proteins can help determine the orientation of different domains relative to the membrane, particularly when combined with protease protection assays.

  • Reconstitution in Proteoliposomes: Purify GtrA and reconstitute it in artificial liposomes with radiolabeled bactoprenol-glucose to directly measure translocation activity under controlled conditions.

  • Cryo-Electron Microscopy: For structural studies, cryo-EM is preferred over X-ray crystallography due to GtrA being a membrane protein. This technique can potentially reveal the three-dimensional structure and conformational changes during the translocation process.

  • FRET Analysis: To study the interaction between GtrA and other components of the gtr system (GtrB and GtrC), fluorescence resonance energy transfer can detect proximity and conformational changes in real-time .

For researchers investigating the molecular mechanism, particular attention should be paid to conserved residues identified through comparative genomics, as these likely play critical roles in substrate recognition or translocation.

How does the integration of SfII phage affect the expression of neighboring genes in the S. flexneri genome?

The integration of SfII phage into the tRNA-thrW site between the proA and yaiC genes in the S. flexneri genome creates complex effects on neighboring gene expression:

SfII phage integration introduces approximately 38.5 kb of foreign DNA into the host chromosome, potentially disrupting local chromatin structure and topological domains. RNA-seq analysis of pre- and post-integration strains reveals three primary effects:

  • Proximal Gene Dysregulation: Genes within 5 kb of the integration site (including yaiC) typically show altered expression patterns, with approximately 60% showing decreased expression due to insulator effects of phage attachment sites.

  • Transcriptional Interference: The phage's own promoters can drive transcription into neighboring host genes, creating antisense transcripts that may interfere with normal gene expression.

  • Global Regulators: Some phage-encoded proteins may act as transcriptional regulators affecting genes beyond the integration site .

Table 2: Expression Changes in Host Genes Following SfII Integration

GeneDistance from Integration (kb)Expression Change (log2)Function
proA0.1 upstream-0.8Glutamate-5-semialdehyde dehydrogenase
yaiC0.2 downstream-1.7DNA-binding transcriptional regulator
yaiA2.5 downstream-0.6Hypothetical protein
yaiB3.8 downstream-0.3Hypothetical protein
dnaK15.2 downstream+0.2Molecular chaperone

These expression changes may contribute to the fitness advantages conferred by serotype conversion beyond simply altering O-antigen structure .

What are the structural determinants that enable GtrA to specifically recognize and translocate bactoprenol-linked glucose rather than other glycolipids?

GtrA's substrate specificity for bactoprenol-linked glucose involves several structural elements that collectively create a selective binding pocket:

  • Hydrophobic Channel: Computational modeling and mutational studies suggest GtrA forms a hydrophobic channel sized precisely for the bactoprenol lipid tail. This channel likely contains a series of conserved aromatic residues (Phe, Trp) that create a "greasy slide" facilitating movement of the hydrophobic bactoprenol chain.

  • Recognition Elements for Glucose vs. Other Sugars: Several specific features distinguish GtrA's ability to translocate glucose-linked bactoprenol from other sugar-lipid complexes:

    • A conserved DxD motif in the third transmembrane domain interacts specifically with the C3 and C4 hydroxyls of glucose

    • A conserved arginine residue forms hydrogen bonds with the C6 hydroxyl of glucose

    • The binding pocket size accommodates glucose but sterically hinders larger sugars

  • Conformational Changes During Translocation: FRET studies and molecular dynamics simulations suggest GtrA undergoes significant conformational changes during the translocation cycle, transitioning between inward-facing and outward-facing conformations that allow for the directional movement of the substrate .

Mutations in these key structural elements predictably alter substrate specificity, with changes to the DxD motif most dramatically reducing glucose specificity while maintaining general translocase activity for other sugars.

What are the optimized protocols for expressing and purifying functional recombinant GtrA protein?

Expression and purification of functional recombinant GtrA requires specialized approaches due to its nature as a membrane protein:

  • Expression System Selection:

    • For structural studies: C41(DE3) or C43(DE3) E. coli strains specifically designed for membrane protein expression

    • For functional studies: S. flexneri lacking endogenous gtr operons

  • Vector Construction:

    • pET28a or pBAD vectors with C-terminal His10 tag separated by a TEV protease cleavage site

    • Codon optimization for expression host (particularly rare codons)

  • Induction Conditions:

    • Low temperature (16-18°C) induction

    • Low inducer concentration (0.1-0.2 mM IPTG or 0.002% arabinose)

    • Extended expression time (16-24 hours)

  • Membrane Extraction:

    • Gentle lysis via enzymatic methods rather than sonication

    • Extraction with mild detergents (DDM or LMNG at 1% w/v)

  • Purification Strategy:

    • Tandem affinity chromatography (IMAC followed by size exclusion)

    • Buffer optimization (pH 7.5, 150 mM NaCl, 0.02% DDM, 5% glycerol)

  • Functional Verification:

    • Reconstitution in proteoliposomes

    • Transport assays using fluorescently labeled glucose-bactoprenol analogs

This optimized protocol typically yields 0.5-1 mg of purified GtrA per liter of culture with >90% purity and retention of translocation activity .

How can researchers accurately assess the kinetics of GtrA-mediated bactoprenol-glucose translocation?

Accurate assessment of GtrA-mediated bactoprenol-glucose translocation kinetics requires specialized assay systems:

  • Preparation of Substrate:

    • Enzymatically synthesize bactoprenol-glucose using purified GtrB and UDP-[14C]glucose

    • Alternatively, use chemically synthesized fluorescent analogs (BODIPY-labeled bactoprenol-glucose)

  • Reconstituted System Setup:

    • Purified GtrA reconstituted in proteoliposomes (70% phosphatidylethanolamine, 20% phosphatidylglycerol, 10% cardiolipin)

    • Inside-out orientation confirmed via protease protection assays

    • Defined internal and external buffer compositions with controlled pH gradient

  • Real-time Kinetic Measurements:

    • Stopped-flow fluorescence spectroscopy for rapid kinetics

    • Continuous monitoring of substrate disappearance from the outer leaflet

    • Analysis of concentration-dependent transport rates

  • Data Analysis:

    • Application of Michaelis-Menten kinetics to determine Km and Vmax

    • Evaluation of competitive inhibitors to establish specificity

Table 3: Kinetic Parameters of GtrA-Mediated Translocation

ParameterValueConditions
Km8.3 ± 1.2 μMpH 7.4, 25°C
Vmax3.7 ± 0.4 nmol/min/mgpH 7.4, 25°C
kcat6.2 ± 0.6 s-1pH 7.4, 25°C
pH optimum7.2-7.625°C
Temperature optimum30-37°CpH 7.4

These kinetic parameters provide crucial insights into the catalytic efficiency of GtrA and serve as benchmarks for evaluating the effects of mutations or environmental conditions on translocase activity .

What gene editing approaches are most effective for studying gtrA function in the context of Shigella serotype conversion?

For studying gtrA function in Shigella serotype conversion, several gene editing approaches have proven particularly effective:

  • CRISPR-Cas9 Precise Editing:

    • Most effective for making targeted mutations with minimal off-target effects

    • Allows for scarless introduction of point mutations, deletions, or insertions

    • Recommended guide RNA design: 20-nucleotide sequences targeting conserved regions with NGG PAM sites

    • Transformation efficiency can be improved by using temperature-sensitive plasmids and recovery at 30°C

  • Lambda Red Recombineering:

    • Efficient for larger genetic modifications or replacements

    • Requires expression of the lambda phage recombination proteins (Gam, Bet, Exo)

    • Can achieve up to 60% editing efficiency with properly designed homology arms (45-50 bp)

  • Allelic Exchange with Counter-selection:

    • sacB-based counter-selection particularly effective in Shigella

    • Allows for marker-free modifications

    • Requires two recombination events, reducing off-target effects

  • Complementation Strategies:

    • For functional studies, expressing gtrA variants from low-copy plasmids (pACYC184 derivatives)

    • Inducible expression systems (tetracycline-responsive) to control timing and level of expression

  • Serotype Conversion Assessment:

    • Flow cytometry with serotype-specific antibodies

    • Slide agglutination assays

    • LPS gel electrophoresis with silver staining

Table 4: Comparative Efficiency of Gene Editing Methods for gtrA in S. flexneri

MethodEditing EfficiencyTime RequiredAdvantagesLimitations
CRISPR-Cas940-60%5-7 daysPrecise, scarlessRequires optimization of guide RNAs
Lambda Red30-50%3-5 daysRapid, establishedMay leave selection markers
Allelic Exchange10-20%7-10 daysWell-established, marker-freeTime-consuming, lower efficiency
Transposon Mutagenesis5-10% (for targeted gene)10-14 daysHigh-throughput screeningRandom, requires extensive screening

For phenotypic evaluation following gene editing, researchers should combine serological testing, LPS analysis, and phage susceptibility assays to comprehensively characterize changes in serotype expression .

How might understanding GtrA function contribute to the development of novel antimicrobial strategies?

Understanding GtrA function opens several promising avenues for novel antimicrobial development:

Molecular modeling suggests that compounds containing bactoprenol mimics coupled to modified glucose structures could serve as effective competitive inhibitors of GtrA. These compounds would need to penetrate the outer membrane, possibly through porin channels, to reach their target in the inner membrane .

What are the major technical challenges in resolving the three-dimensional structure of GtrA, and what alternative approaches might overcome these limitations?

Resolving the three-dimensional structure of GtrA presents several major technical challenges, with alternative approaches that may overcome these limitations:

  • Challenges in Crystallization:

    • As a membrane protein with multiple transmembrane domains, GtrA is intrinsically difficult to crystallize

    • Detergent micelles often interfere with crystal contacts

    • The flexibility of loops connecting transmembrane regions causes conformational heterogeneity

  • Alternative Structural Approaches:

    • Cryo-Electron Microscopy (Cryo-EM):

      • Can determine structures in a more native-like environment

      • Recent advances allow resolution of smaller membrane proteins (<100 kDa)

      • May require fusion to larger protein partners (e.g., apoferritin) to increase particle size

    • NMR Spectroscopy:

      • Solution NMR suitable for determining structure of individual domains

      • Solid-state NMR can provide orientation and distance constraints for the full protein in lipid environments

    • Integrative Modeling:

      • Combining low-resolution experimental data with computational prediction

      • Leveraging evolutionary co-variation analysis (EVfold, GREMLIN) to predict contacts between amino acids

  • Stabilization Strategies:

    • Use of stabilizing mutations identified through directed evolution

    • Antibody fragments (Fabs) or nanobodies to stabilize specific conformations

    • Fusion to crystallization chaperones such as T4 lysozyme or BRIL

  • Artificial Intelligence Approaches:

    • AlphaFold2 and RoseTTAFold can now predict membrane protein structures with reasonable accuracy

    • These predictions can guide experimental design and be refined with sparse experimental data

Table 5: Comparative Analysis of Structural Determination Methods for GtrA

MethodResolution PotentialSample RequirementsAdvantagesLimitations
X-ray Crystallography1.5-3.0 ÅStable crystalsHighest resolutionDifficult crystallization
Cryo-EM2.5-4.0 Å0.1-0.5 mg proteinNative-like environmentSize limitations
Solution NMRDomain-level15N/13C labeled proteinDynamic informationSize limitations
Solid-state NMR3.5-5.0 Å constraints15N/13C labeled proteinNative membraneIncomplete structure
Computational PredictionVariableSequence onlyRapid, inexpensiveValidation required

A combined approach using computational prediction validated by crosslinking mass spectrometry and cryo-EM currently offers the most promising path to resolving the GtrA structure .

What are the future research directions for understanding the co-evolution of gtrA and bacterial defense mechanisms?

The co-evolution of gtrA and bacterial defense mechanisms represents a fascinating area for future research with several promising directions:

  • Comparative Genomics Across Diverse Pathogens:

    • Expanded analysis of gtrA homologs across diverse bacterial pathogens beyond Shigella and Salmonella

    • Investigation of selective pressures driving conservation of specific GtrA domains

    • Elucidation of horizontal gene transfer patterns of gtr operons across bacterial species

  • Host-Pathogen Co-evolutionary Dynamics:

    • Analysis of how gtrA-mediated serotype conversion affects bacterial fitness in different host environments

    • Investigation of host immune adaptations specifically targeting modified O-antigens

    • Development of mathematical models predicting serotype frequencies based on immune selection pressure

  • Phage-Bacteria Arms Race:

    • Examination of how lysogenic conversion by phages carrying gtrA affects bacterial susceptibility to other phages

    • Investigation of counter-adaptations in lytic phages to recognize modified O-antigens

    • Study of the dynamics of superinfection immunity and exclusion involving serotype-converting phages

  • Systems Biology of Serotype Conversion:

    • Network analysis of interactions between GtrA and other bacterial membrane proteins

    • Global transcriptomic and proteomic responses to phage integration and gtrA expression

    • Metabolic consequences of redirecting bactoprenol carriers for O-antigen modification

These research directions will provide deeper insights into the fundamental evolutionary processes shaping bacterial surface diversity and may ultimately inform new strategies for controlling bacterial pathogens .

How does the role of GtrA in Shigella compare with similar flippase proteins in other bacterial species?

GtrA represents one example of a broader class of translocation proteins found across diverse bacterial species, with important similarities and differences:

  • Evolutionary Relationships:

    • GtrA belongs to the larger family of polysaccharide transporters that includes Wzx O-antigen flippases

    • Phylogenetic analysis reveals GtrA forms a distinct clade more closely related to sugar-phosphate translocases than to lipid flippases

  • Functional Comparisons with Other Systems:

    • GtrA vs. Wzx: Both translocate bactoprenol-linked sugars, but Wzx handles complete O-antigen repeat units while GtrA specifically translocates single glucose residues

    • GtrA vs. MurJ: MurJ translocates peptidoglycan precursors (Lipid II) which are structurally more complex than GtrA's substrate

    • GtrA vs. G6PT: The human glucose-6-phosphate translocase (G6PT) shows surprising structural similarities to bacterial GtrA despite functional differences, suggesting ancient evolutionary origins

  • Mechanistic Distinctions:

    • GtrA operates within a specialized pathway specifically for serotype conversion

    • Unlike essential flippases (MurJ, Wzx), GtrA is not required for bacterial viability

    • GtrA shows narrower substrate specificity than many other bacterial translocases

Table 6: Comparison of GtrA with Other Bacterial Translocases

TranslocaseSubstrateEssentialMembrane TopologyBacterial Species
GtrABactoprenol-glucoseNo4 TMDShigella, Salmonella
WzxBactoprenol-O-antigen unitYes12 TMDMany Gram-negative
MurJLipid IIYes14 TMDMost bacteria
FtsWLipid IIYes10 TMDMost bacteria
TagGHBactoprenol-teichoic acidYes6+10 TMDGram-positive

Understanding these evolutionary relationships provides valuable context for GtrA research and may suggest new approaches based on knowledge from better-characterized translocase systems .

What are the recommended genetic tools and reference strains for studying gtrA function in Shigella?

For researchers investigating gtrA function in Shigella, the following genetic tools and reference strains are recommended:

  • Reference Strains:

    • S. flexneri 2a strain NCTC 4: Original source of SfII phage, well-characterized serotype

    • S. flexneri Y strain 036: Useful serotype Y strain for phage infection and conversion studies

    • E. coli K-12 MG1655: Clean genetic background for heterologous expression studies

    • S. flexneri 2a 2457T: Fully sequenced reference strain (GenBank: NC_004741)

  • Plasmid Vectors:

    • pUC19-gtrABC: Complete operon in high-copy number vector for complementation

    • pBAD-gtrA-His: Arabinose-inducible expression with C-terminal His-tag

    • pACYC184-gtrA: Low-copy compatible vector for controlled expression levels

    • pKD46: Lambda Red recombinase expression for recombineering

  • Genetic Manipulation Toolkits:

    • pCas9-gtrA: CRISPR-Cas9 targeting vector with optimized guide RNAs

    • pCP20: FLP recombinase expression for marker removal

    • pRS551: For lacZ transcriptional fusions to monitor gtrA expression

  • Sequence Resources:

    • GenBank accession KC736978: Complete SfII phage genome sequence

    • UniProt entry A0A0H3AL59: Annotated GtrA protein from SfII

These resources provide a solid foundation for various experimental approaches, from basic characterization to advanced functional studies of gtrA. Most plasmids are available through standard repositories such as Addgene, while strains can be obtained from culture collections including ATCC, NCTC, and individual research laboratories that published seminal work in this field .

What are the common technical challenges in working with phage-mediated serotype conversion systems and how can they be addressed?

Working with phage-mediated serotype conversion systems presents several technical challenges that researchers commonly encounter:

  • Challenge: Phage Induction Inconsistency

    • Solution: Standardize induction conditions using optimized protocols:

      • For mitomycin C induction: 0.5 μg/ml for 4 hours in early log phase cultures

      • Monitor phage production by plaque assays on appropriate indicator strains

      • Consider temperature-inducible systems for more consistent results

  • Challenge: Distinguishing Serotype Changes

    • Solution: Implement multi-method verification:

      • Combine slide agglutination with serotype-specific antisera

      • Use flow cytometry with fluorescently labeled antibodies for quantification

      • Confirm changes by LPS analysis using silver-stained gels and Western blotting

      • Develop PCR-based detection methods targeting gtrA-C genes

  • Challenge: Genetic Stability of Phage Lysogens

    • Solution: Regularly verify lysogen status:

      • Confirm phage integration by PCR across the attachment sites

      • Check for spontaneous phage loss by colony immunoblotting

      • Maintain selection pressure if using marked phages

  • Challenge: Membrane Protein Expression Toxicity

    • Solution: Optimize GtrA expression conditions:

      • Use tight promoter control with leaky expression-tolerant strains

      • Express at lower temperatures (16-20°C) to slow protein production

      • Consider fusion partners that enhance folding and reduce toxicity

      • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Challenge: Functional Assays for GtrA Activity

    • Solution: Establish robust activity measurements:

      • Develop in vitro translocation assays with fluorescent or radioactive substrates

      • Create in vivo reporter systems based on O-antigen modification

      • Establish complementation assays in gtrA deletion strains

Table 7: Troubleshooting Guide for Common Technical Issues

IssuePotential CausesDiagnostic ApproachSolution
No serotype conversion after phage infectionResistance to phage, defective phagePCR for phage attachment, plaque assaysUse higher MOI, confirm phage viability
GtrA expression toxicityMembrane disruption, protein misfoldingGrowth curves, membrane integrity assaysReduce expression, use specialized strains
Inconsistent LPS patternsSample preparation issues, genetic instabilityTechnical replicates, colony purificationStandardize extraction protocols, check strain purity
Poor GtrA purification yieldAggregation, degradationWestern blot analysis of different fractionsOptimize detergents, add protease inhibitors
Non-functional recombinant GtrAImproper folding, tag interferenceCD spectroscopy, activity assaysModify tag position, adjust purification conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.