Recombinant Shigella phage SfV Bactoprenol glucosyl transferase (gtrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
gtrB; 24; Bactoprenol glucosyl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Shigella phage SfV (Shigella flexneri bacteriophage V) (Bacteriophage SfV)
Target Names
gtrB
Target Protein Sequence
MKISLVVPVFNEEEAIPVFYKTVREFQELKPYEVEIVFINDGSKDATESIINALAVSDPL VVPLSFTRNFGKEPALFAGLDHASGDAVIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRLKRKTAEWFYKLHNKISTPKIEENVGDFRLMSREVVENIKLLPERNLFMKGI LSWVGGQTDVVEYVRAERVAGISKFNGWKLWNLALEGITSFSTFPLRVWTYIGLFVASIS FLYGAWMIIDTLVFGNPVRGYPSLLVSILFLGGVQLIGIGVLGEYIGRIYIESKHRPKYI IKNEKQK
Uniprot No.

Target Background

Function

Involved in O antigen modification. This enzyme catalyzes the transfer of a glucose residue from UDP-glucose to a lipid carrier.

Database Links

KEGG: vg:935195

Protein Families
Glycosyltransferase 2 family, GtrB subfamily
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Shigella phage SfV Bactoprenol glucosyl transferase (gtrB) and what is its role in O-antigen modification?

Shigella phage SfV Bactoprenol glucosyl transferase (gtrB) is the second gene in a three-gene cluster responsible for serotype conversion in Shigella flexneri. The gtrB protein specifically catalyzes the transfer of glucose from UDP-glucose to bactoprenol phosphate in the cytoplasm, forming UndP-β-glucose (bactoprenol-linked glucose), which serves as the essential substrate for subsequent O-antigen glycosylation reactions . This transferase functions in concert with other proteins encoded by the gtr gene cluster to facilitate the modification of bacterial surface antigens that ultimately alters bacterial serotype and recognition by the host immune system .

How does gtrB fit into the three-gene cluster system for serotype conversion?

The gtrB gene functions as part of a coordinated three-gene cluster (gtrA-gtrB-gtr(type)) found in bacteriophages that mediate serotype conversion in bacteria like Shigella flexneri. In this system, each gene has a specialized role: (1) gtrA encodes a small highly hydrophobic protein that facilitates the translocation of lipid-linked glucose across the cytoplasmic membrane; (2) gtrB encodes the bactoprenol glucosyltransferase that synthesizes the UndP-β-glucose intermediate; and (3) the gtr(type) gene (such as gtrX in SfX phage) encodes a bacteriophage-specific glucosyltransferase that attaches the glucosyl residue to the appropriate position on the O-antigen repeating unit . Together, these three proteins form a complete biochemical pathway for bacteriophage-mediated serotype conversion in S. flexneri .

What structural features characterize the gtrB protein?

The gtrB protein features hydrophobic domains characteristic of membrane-associated enzymes, consistent with its role in cytoplasmic synthesis of lipid-linked oligosaccharides. While specific structural details of the Shigella phage SfV gtrB remain partially characterized, comparative analyses with similar glucosyltransferases suggest it contains conserved catalytic domains for nucleotide sugar (UDP-glucose) binding and glycosyl transfer activities . The protein likely contains transmembrane domains that facilitate interaction with the lipid substrate bactoprenol phosphate at the cytoplasmic face of the inner membrane, where the enzymatic transfer of glucose occurs before the product is flipped to the periplasmic space by GtrA for further modification .

What are the optimal expression systems for recombinant production of functional gtrB?

For functional expression of Shigella phage SfV gtrB, E. coli-based expression systems using pET or pBAD vectors under the control of inducible promoters (such as T7 or arabinose-inducible promoters) have proven most effective. When expressing gtrB, researchers should consider:

  • Temperature optimization: Expression at 25-30°C rather than 37°C often yields higher amounts of properly folded protein

  • Co-expression with molecular chaperones when necessary to enhance proper folding

  • Inclusion of a C-terminal purification tag (His6) rather than N-terminal tags to minimize interference with membrane interactions

  • Use of specialized E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3))

The protein's membrane-associated nature necessitates careful optimization of detergent solubilization conditions during purification, with mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) often yielding superior results compared to harsher ionic detergents .

How can researchers effectively assay gtrB enzymatic activity in vitro?

Functional assessment of gtrB activity can be performed using multiple complementary approaches:

Assay TypeMethodologyAdvantagesLimitations
Radioactive AssayMeasure transfer of [14C]-glucose from UDP-[14C]-glucose to bactoprenol phosphateHigh sensitivity; direct quantification of enzyme activityRequires radioisotope handling; specialized equipment
HPLC AnalysisMonitor consumption of UDP-glucose and formation of UndP-glucoseDoesn't require radioactivity; quantitativeLower sensitivity; requires standards
Mass SpectrometryIdentify and quantify reaction productsHigh specificity; structural informationExpensive equipment; complex sample preparation
Coupled Enzyme AssayLink UDP production to NADH oxidation via pyruvate kinase and lactate dehydrogenaseContinuous monitoring; amenable to high-throughputIndirect measurement; potential interference

For optimal results, reactions should contain purified gtrB protein or membrane fractions, UDP-glucose as donor substrate, bactoprenol phosphate as acceptor substrate, and appropriate divalent cations (typically Mg2+ or Mn2+) in a buffered system at pH 7.0-8.0 .

What expression vector systems are most suitable for studying the entire gtrA-gtrB-gtr(type) operon?

When investigating functional interactions within the complete gtrA-gtrB-gtr(type) system, researchers should consider using:

  • Polycistronic expression vectors that maintain the natural gene arrangement and stoichiometry

  • Dual or triple plasmid systems with compatible origins of replication when individual control of each component is needed

  • BAC (Bacterial Artificial Chromosome) systems for maintaining larger genomic contexts

The natural operon structure should be preserved when possible, including appropriate intergenic regions that may contain regulatory elements. For functional complementation studies in Shigella, shuttle vectors like pACYC184 derivatives that can replicate in both E. coli and Shigella have proven effective for expressing the complete gene cluster under native or inducible promoter control .

How does gtrB activity coordinate with GtrA and Gtr(type) proteins in the complete O-antigen modification pathway?

The coordinated activity of the three Gtr proteins forms a sophisticated biochemical pathway:

  • GtrB catalyzes the initial step of glucose activation by transferring glucose from UDP-glucose to bactoprenol phosphate in the cytoplasm, creating UndP-β-glucose

  • GtrA, a small hydrophobic protein with multiple transmembrane domains, functions as a flippase to translocate the UndP-β-glucose from the cytoplasmic face to the periplasmic face of the inner membrane

  • Gtr(type) (the serotype-specific glucosyltransferase) then transfers the glucose residue from UndP-β-glucose to a specific position on the O-antigen repeat unit

What are the critical residues in gtrB that determine substrate specificity and catalytic activity?

While comprehensive mutational analysis data specific to Shigella phage SfV gtrB is limited, comparative analysis with related glycosyltransferases suggests several conserved structural elements likely critical for function:

  • DXD motif: A characteristic sequence in many glycosyltransferases that coordinates the metal ion and UDP-glucose

  • Hydrophobic regions: Important for membrane association and interaction with the lipid substrate

  • C-terminal domain: Likely involved in UDP-glucose binding based on homology with other glycosyltransferases

Amino acid residues involved in UDP-glucose binding are generally more conserved across different gtrB proteins than those involved in lipid substrate recognition, reflecting the common donor substrate but potentially different acceptor specificities. Site-directed mutagenesis studies targeting these conserved residues would provide valuable insights into structure-function relationships in gtrB enzymes .

How does bacterial lipid composition affect gtrB activity and O-antigen modification efficiency?

The lipid environment significantly impacts gtrB function through several mechanisms:

  • Availability of bactoprenol phosphate substrate is directly influenced by competing cellular pathways that utilize this limited lipid carrier

  • Membrane fluidity, determined by phospholipid composition, affects the lateral mobility of lipid-linked intermediates and the efficiency of their utilization

  • The presence of cardiolipin-rich domains may create microenvironments that facilitate the assembly of functional glycosylation complexes

Experimental manipulation of membrane composition through genetic approaches (modifying phospholipid biosynthesis genes) or chemical methods (supplementation with specific lipids) can significantly alter the efficiency of gtrB-mediated glycosylation. This lipid dependency represents both a research challenge and a potential point for targeted intervention in serotype conversion processes .

How conserved is gtrB across different bacteriophages that mediate serotype conversion?

Comparative genomic analysis reveals that gtrB genes are highly conserved across diverse serotype-converting bacteriophages, showing 70-90% amino acid sequence identity despite differences in the bacterial hosts and serotype specificities. This conservation reflects functional constraints on the core enzymatic mechanism of UDP-glucose transfer to bactoprenol. In contrast, the gtr(type) genes show significant sequence diversity, corresponding to their role in determining serotype specificity.

This pattern suggests that bacteriophage evolution has maintained a core glycosylation machinery (gtrA and gtrB) while diversifying the specificity-determining components (gtr(type)), likely through horizontal gene transfer and recombination events. Similar gtrA-gtrB-gtr(type) glycosylation cassettes have been identified in various Salmonella strains, suggesting broader distribution of these phage-origin modification systems beyond Shigella .

What structural and functional relationships exist between phage-encoded gtrB and similar bacterial enzymes?

Phage-encoded gtrB proteins share significant structural and functional similarities with bacterial enzymes involved in cell envelope biosynthesis, particularly those catalyzing the initial steps of O-antigen assembly and peptidoglycan synthesis. Key relationships include:

  • Homology with WbaP and related bacterial glycosyltransferases involved in initiating O-antigen synthesis

  • Functional parallels with MurG, which catalyzes peptidoglycan precursor synthesis using UDP-sugars and lipid carriers

  • Structural similarities with other bacterial glycosyltransferases that utilize nucleotide-activated sugars

These relationships suggest that bacteriophages have likely acquired and adapted bacterial glycosyltransferase genes for their own purposes. This evolutionary adaptation allows phages to modify host surface structures, potentially enhancing their infection capabilities or altering host susceptibility to other phages. The consistent organization of the three-gene gtr cluster across diverse phages further supports the hypothesis of modular acquisition and maintenance of this functional cassette .

How can recombinant gtrB be utilized to study bacteriophage-mediated serotype conversion mechanisms?

Recombinant gtrB serves as a valuable tool for dissecting the molecular basis of serotype conversion:

  • In vitro reconstitution systems combining purified GtrA, GtrB, and Gtr(type) proteins can be established to analyze the complete pathway under controlled conditions

  • Fluorescently labeled lipid substrates and UDP-glucose analogs enable real-time monitoring of glycosylation reactions and substrate translocation

  • Synthetic membrane systems (liposomes or nanodiscs) containing reconstituted gtrB can help define minimal requirements for activity

These experimental approaches provide mechanistic insights into the coordinated process of O-antigen modification and help identify potential targets for intervention in serotype conversion processes .

What are the implications of understanding gtrB function for developing new antimicrobial strategies?

Understanding gtrB function has several potential applications in antimicrobial development:

  • Inhibitors targeting gtrB could prevent serotype conversion, maintaining bacterial susceptibility to serotype-specific host immunity or therapeutic bacteriophages

  • The structural similarity between gtrB and bacterial glycosyltransferases involved in essential cell envelope biosynthesis suggests potential for developing broad-spectrum inhibitors

  • Manipulating serotype conversion could enhance the efficacy of existing vaccines by preventing antigenic variation

The relatively high conservation of gtrB across different bacteriophages makes it an attractive target for broad inhibition of serotype conversion in various bacterial pathogens. Additionally, understanding the molecular details of gtrB function contributes to our fundamental knowledge of membrane-associated glycosylation processes that are essential for bacterial viability and pathogenesis .

How might CRISPR-Cas and other genetic tools be applied to study gtrB in its native context?

Advanced genetic tools offer new approaches for investigating gtrB function:

  • CRISPR-Cas9 systems allow precise genome editing to:

    • Create point mutations in critical residues

    • Generate fluorescent protein fusions for localization studies

    • Establish inducible expression systems for temporal control

  • CRISPRi (CRISPR interference) enables tunable repression of gtrB expression to study dose-dependent effects

  • Transposon sequencing (Tn-seq) approaches can identify genetic interactions and contextual factors affecting gtrB function

  • Single-molecule tracking techniques using photoactivatable fluorescent proteins can monitor the dynamics of GtrB within the membrane

These approaches enable investigation of gtrB function in its native context, providing insights into factors affecting enzyme activity, localization, and interaction with other components of the serotype conversion machinery that may not be apparent in in vitro systems .

What are common challenges in expressing and purifying functional recombinant gtrB?

Researchers frequently encounter several challenges when working with recombinant gtrB:

ChallengePotential Solutions
Poor expressionOptimize codon usage; lower induction temperature (25°C); use specialized expression strains
Inclusion body formationExpress as fusion with solubility-enhancing tags (MBP, SUMO); co-express with chaperones
Membrane extractionTest different detergents (DDM, LDAO, Triton X-100); optimize detergent:protein ratios
Loss of activity during purificationInclude stabilizing agents (glycerol, specific lipids); minimize purification steps
AggregationAdd glycerol or non-ionic detergents; maintain low protein concentration during storage

Additionally, enzymatic activity often depends on maintaining a native-like membrane environment. Reconstitution into liposomes or nanodiscs containing E. coli lipids can help restore activity of purified gtrB protein, particularly for kinetic and substrate specificity studies .

How can researchers address data inconsistencies in gtrB functional studies?

When encountering inconsistent results in gtrB functional studies, researchers should systematically evaluate:

  • Protein quality and integrity:

    • Verify protein folding using circular dichroism or limited proteolysis

    • Confirm membrane association through fractionation studies

    • Assess aggregation state by size exclusion chromatography

  • Assay conditions:

    • Optimize buffer composition, pH, and ionic strength

    • Test different divalent cation requirements (Mg2+, Mn2+)

    • Evaluate substrate quality and purity (especially lipid components)

  • Experimental controls:

    • Include enzymatically inactive mutants as negative controls

    • Verify UDP-glucose quality and integrity

    • Ensure detergent concentrations remain below inhibitory levels

Standardization of experimental protocols across research groups would facilitate comparison of results and accelerate progress in understanding gtrB function. Development of a consensus in vitro activity assay, similar to standardized protocols for other challenging enzyme systems, would be particularly valuable .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.