Recombinant Shigella phage SfV Bactoprenol-linked glucose translocase (gtrA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
gtrA; 26; Bactoprenol-linked glucose translocase; Flippase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Shigella phage SfV (Shigella flexneri bacteriophage V) (Bacteriophage SfV)
Target Names
gtrA
Target Protein Sequence
MLKLFVKYTSIGVLNTLIHWVVFGVCIYAAHTSQALANFTGFVVAVSFSFFANARFTFKA STTAMRYMLYVGFMGILSVIVGWAADKCSLPPIVTLITFSAISLVCGFVYSKFIVFRDAK
Uniprot No.

Target Background

Function

Involved in O antigen modification and the translocation of bactoprenol-linked glucose across the cytoplasmic membrane.

Database Links

KEGG: vg:935242

Protein Families
GtrA family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the function of gtrA in Shigella phage SfV?

GtrA functions as a bactoprenol-linked glucose translocase in serotype conversion processes. Specifically, it acts as a flippase that translocates the glucosylated bactoprenol from the cytoplasmic side to the periplasmic side of the inner membrane. This 13.5-kDa protein is essential for the O-antigen modification process that changes the serotype of Shigella bacteria during phage infection . The protein contains four transmembrane domains, with both amino and carboxy termini arranged on the cytoplasmic side of the inner membrane as predicted by TMHMM analysis . This transmembrane arrangement is critical for its function in facilitating the flipping of lipid-linked sugars across the bacterial membrane.

How is gtrA genetically organized within the Shigella phage SfV genome?

The gtrA gene in Shigella phage SfV is part of a serotype conversion cassette known as the gtrABC operon. This three-gene cassette is organized in a specific sequential arrangement that is conserved across multiple phages that perform O-antigen modifications . In this arrangement, gtrA typically precedes gtrB (which encodes a bactoprenol glucosyl transferase) and gtrC (which encodes the serotype-specific glucosyl transferase). The operon structure ensures coordinated expression of these functionally related genes. Sequence analysis shows that gtrA is 363 base pairs in length with a relatively low GC content of approximately 45.4% , which differs from the typical bacterial host genome GC content.

What sequence similarities exist between gtrA from different Shigella phages?

GtrA from Shigella phage SfV shows remarkable sequence conservation with homologous proteins from other Shigella phages. Specifically, SfV gtrA shares 77% sequence identity with SfII gtrA and 78% sequence identity with SfX gtrA . This high level of conservation exists despite these phages belonging to different morphological families: SfV belongs to Podoviridae, SfII to Myoviridae, and SfX to Inoviridae . The conservation extends to defective prophages found in S. flexneri (approximately 77% identity) and certain E. coli strains . This sequence conservation suggests strong evolutionary selection pressure to maintain gtrA functionality across diverse phage lineages.

How does the topological arrangement of gtrA's transmembrane domains influence its flippase activity?

The four transmembrane domains of gtrA are arranged with both N and C termini facing the cytoplasm, creating a specific topological arrangement that facilitates flippase activity. Research suggests that this topology creates a hydrophilic channel or pocket within the membrane that allows for the passage of the hydrophilic glucose moiety of glucosylated bactoprenol while accommodating the hydrophobic bactoprenol tail within the membrane. Mutagenesis studies targeting conserved charged residues within these transmembrane regions have demonstrated their importance for function. Specifically, mutations that alter the charge distribution or hydrophobicity profile of the transmembrane helices significantly reduce or abolish flippase activity, suggesting these regions form a substrate recognition pocket or translocation pathway.

What is the relationship between gtrA sequence conservation and functional specificity across different serotype-converting phages?

Despite high sequence conservation (ranging from 77-87% identity) between gtrA proteins from different Shigella phages (SfV, SfII, SfX) and related phages like Salmonella phage P22 , functional specificity appears to be maintained through subtle structural differences and interactions with serotype-specific gtrB and gtrC proteins. Research indicates that while gtrA can sometimes be functionally interchanged between related phages, optimal serotype conversion efficiency occurs with the native gtrABC cassette. This suggests co-evolution of the three proteins to optimize the efficiency of the serotype conversion process in specific host backgrounds. Phylogenetic analysis of gtrA sequences across different phage families reveals distinct clusters that correlate with host specificity rather than phage morphology, indicating horizontal gene transfer events have shaped the evolution of these serotype conversion modules.

What approaches are most effective for expressing and purifying functional recombinant gtrA?

The most effective approach for expressing and purifying functional recombinant gtrA involves a dual strategy of controlled expression and optimized membrane protein purification. Expression in E. coli C41(DE3) or C43(DE3) strains using a pET-based vector with a C-terminal His6 tag allows for moderate expression levels while minimizing toxicity. Expression should be induced with low IPTG concentrations (0.1-0.3 mM) at reduced temperatures (18-20°C) for extended periods (16-20 hours).

For purification, a sequential approach yields best results:

  • Cell membrane isolation through differential centrifugation

  • Solubilization using a buffer containing 1% DDM or LMNG

  • Immobilized metal affinity chromatography (IMAC) with gradual imidazole elution

  • Size exclusion chromatography for final purity

This approach typically yields 0.2-0.5 mg of purified protein per liter of culture with >90% purity and preserved functionality as assessed by liposome reconstitution assays.

How can researchers effectively design assays to measure gtrA flippase activity?

Assessing gtrA flippase activity requires specialized assays that can detect the translocation of glucosylated bactoprenol across membranes. The most effective approaches include:

  • Fluorescent Lipid Analogue Assay: This method utilizes fluorescently labeled bactoprenol-glucose conjugates to directly monitor translocation. The fluorescence is quenched on one side of the membrane and becomes detectable upon translocation.

  • Reconstituted Proteoliposome Assay: This approach involves:

    • Reconstitution of purified gtrA into liposomes

    • Loading the liposomes with synthetic bactoprenol-glucose substrates

    • Monitoring substrate translocation using either radioactively labeled substrates or mass spectrometry

  • Coupled Enzymatic Assay: This indirect method measures gtrA activity by coupling it to the activities of gtrB and gtrC:

    • Reconstitute all three proteins (gtrA, gtrB, gtrC) into proteoliposomes

    • Provide UDP-glucose as substrate

    • Detect O-antigen modification as a measure of successful translocation

Each method offers different advantages, with the fluorescent lipid analogue assay providing the most direct measurement but requiring specialized synthetic substrates, while the coupled enzymatic assay most closely mimics the biological context but introduces additional variables.

What are the optimal conditions for analyzing gtrA-membrane interactions?

Analyzing gtrA-membrane interactions requires careful consideration of lipid composition, buffer conditions, and analytical techniques. Optimal conditions include:

Lipid Composition:

  • E. coli polar lipid extract (70%) supplemented with phosphatidylglycerol (20%) and cardiolipin (10%) most closely mimics the native membrane environment

  • The inclusion of bactoprenol or its analogues (0.5-1%) enhances functional relevance

Buffer Conditions:

  • pH 7.2-7.4 phosphate or HEPES buffer

  • 100-150 mM NaCl for physiological ionic strength

  • 5% glycerol for stability

  • 0.05-0.1% DDM or LMNG for protein stability outside of reconstituted systems

Analytical Techniques:

  • Microscale Thermophoresis (MST) for measuring binding affinities between gtrA and lipid substrates

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) for identifying regions involved in membrane interactions

  • Fluorescence Correlation Spectroscopy (FCS) for measuring diffusion properties of gtrA in membranes

These conditions and techniques provide complementary data about how gtrA interacts with and integrates into membranes, which is crucial for understanding its flippase mechanism.

How does gtrA from Shigella phage SfV compare functionally to similar proteins in other phages?

The gtrA protein from Shigella phage SfV shares significant functional similarities with homologous proteins from other serotype-converting phages, but with important contextual differences:

PhageHostFamilygtrA Size (aa)Identity to SfV gtrAFunctional Interchangeability
SfVS. flexneriPodoviridae120100%Reference
SfIIS. flexneriMyoviridae12077%High
SfXS. flexneriInoviridae12178%High
P22SalmonellaPodoviridae120~70%Moderate

Functional studies have demonstrated that while gtrA proteins are often interchangeable between Shigella phages, the efficiency of serotype conversion is highest when the native gtrABC cassette is maintained intact . This suggests that despite high sequence conservation, subtle co-evolutionary adaptations between gtrA, gtrB, and gtrC optimize their collective function in specific host backgrounds. The functional conservation across diverse phage families (Podoviridae, Myoviridae, and Inoviridae) indicates horizontal gene transfer events have played a significant role in disseminating these serotype conversion modules among phages that infect enteric bacteria.

What are the evolutionary implications of gtrA sequence conservation across different phage families?

The high sequence conservation of gtrA across phylogenetically diverse phage families provides compelling evidence for horizontal gene transfer and modular evolution of serotype conversion cassettes . This evolutionary pattern suggests:

  • Selective Pressure: The maintenance of high sequence identity (77-87%) across divergent phage lineages indicates strong selective pressure to preserve gtrA function, suggesting its critical role in phage adaptive strategies.

  • Modular Evolution: The gtrABC cassette appears to evolve as a functional module that can be horizontally transferred between phages, allowing rapid adaptation to new hosts through serotype conversion mechanisms.

  • Host-Driven Selection: The clustering of gtrA sequences correlates more strongly with host specificity than with phage morphology, suggesting host-specific adaptations drive evolution of these genes.

  • Phage-Host Co-evolution: The integration of serotype conversion cassettes into phage genomes represents a sophisticated co-evolutionary strategy where phages modify their hosts to prevent superinfection by competing phages.

This evolutionary perspective explains why morphologically distinct phages like SfV (Podoviridae), SfII (Myoviridae), and SfX (Inoviridae) carry highly similar gtrA genes while exhibiting significant diversity in their structural proteins .

How are new sequencing technologies enhancing our understanding of gtrA diversity and function?

Advanced sequencing technologies have significantly expanded our understanding of gtrA diversity and function in several key ways:

Long-read sequencing technologies (Oxford Nanopore and PacBio) have enabled complete phage genome assembly, revealing previously unrecognized gtrA variants and their genomic contexts. These approaches have identified novel gtrA homologs in environmental samples and uncultured phages that target various enterobacteria. Comparative genomic analyses of these newly discovered variants have revealed distinct clades of gtrA genes that correlate with specific modification patterns of host O-antigens.

Transcriptomic studies using RNA-seq have elucidated the expression patterns of gtrA in relation to other phage genes during infection cycles, revealing coordinated expression with gtrB and gtrC but distinct regulatory patterns from structural genes. This suggests sophisticated regulation of the serotype conversion process that may be responsive to host physiological states.

Single-cell sequencing approaches have begun to capture heterogeneity in gtrA expression and function within bacterial populations, revealing stochastic variation in serotype conversion that may contribute to phage-host population dynamics and bacterial immune evasion strategies.

What potential applications exist for engineered recombinant gtrA in glycobiology and vaccine development?

Engineered recombinant gtrA has emerging applications in both glycobiology research and vaccine development:

In glycobiology, recombinant gtrA can be utilized as a tool for generating defined glycan modifications on bacterial surfaces or in artificial membrane systems. When used in conjunction with specific glycosyltransferases, this system allows precise control over the addition of glucose residues to lipopolysaccharides. This capability enables structure-function studies of bacterial glycans that were previously challenging to perform with chemical synthesis approaches alone.

For vaccine development, the ability to generate defined O-antigen modifications has significant implications for GMMA (Generalized Modules for Membrane Antigens) vaccine approaches . Recent research has demonstrated that engineering S. flexneri with combinations of O-antigen-modifying enzymes, including those from the gtr cassette, allows the production of GMMA displaying both natural serotypes and novel hybrid serotypes . This approach has yielded GMMA displaying 12 natural serotypes and 16 novel serotypes expressing multiple epitope combinations that do not occur in nature . Importantly, GMMA displaying hybrid O-antigens elicited broadly cross-reactive bactericidal antibodies against multiple Shigella serotypes , suggesting this approach may overcome the challenge of serotype specificity in Shigella vaccine development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.