Recombinant Shigella phage SfX Bactoprenol-linked glucose translocase (gtrA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
gtrA; Bactoprenol-linked glucose translocase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Shigella phage SfX (Shigella flexneri bacteriophage X) (Bacteriophage SfX)
Target Names
gtrA
Target Protein Sequence
MLKLFAKYTSIGVLNTLIHWVVFGVCIYAAHTNQAMANFAGFVVAVSFSFFANAKFTFKA STTTMRYMLYVGFMGTLSATVGWVADRCSLPPIVTLVTFSAISLVCGFVYSKFIVFRDAK
Uniprot No.

Target Background

Function

This protein is involved in O antigen modification and the translocation of bactoprenol-linked glucose across the cytoplasmic membrane.

Protein Families
GtrA family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is the function of gtrA in Shigella phage SfX?

The gtrA gene in Shigella phage SfX encodes a Bactoprenol-linked glucose translocase, a membrane-associated enzyme responsible for flipping glucosyl-bactoprenol from the cytoplasmic side to the periplasmic side of the bacterial inner membrane. This process is crucial for serotype conversion in Shigella, where the O-antigen structure is modified through the addition of glucose residues. The gtrA protein works in concert with gtrB (a glucosyltransferase) and gtrX (a serotype-specific glucosyltransferase) to modify the bacterial O-antigen, thereby altering phage-host specificity and potentially helping the bacterium evade host immune responses.

Functional studies of gtrA typically involve gene deletion and complementation experiments, followed by analyses of O-antigen structure using techniques such as HPLC, mass spectrometry, and serological assays. In the broader context of phage biology, gtrA represents a component of the complex machinery that phages employ to manipulate their hosts during infection cycles.

How does gtrA interact with the bacterial host machinery?

The interaction between gtrA and bacterial host machinery involves complex membrane dynamics. The gtrA protein inserts into the bacterial inner membrane, where it interacts with the bacterial lipid bilayer and potentially other membrane proteins. To study these interactions, researchers employ multiple experimental approaches:

  • Bacterial two-hybrid systems to identify protein-protein interactions

  • Fluorescently tagged gtrA to visualize localization via confocal microscopy

  • Co-immunoprecipitation assays to pull down interaction partners

  • Liposome reconstitution experiments to study function in a defined membrane environment

The integration of gtrA into bacteriophage genomes suggests an evolutionary advantage, potentially allowing phages to modify their bacterial hosts' surface properties to prevent superinfection by competing phages. This is part of the co-evolutionary dynamics between Shigella and its infecting phages, where both organisms continuously develop new strategies in an evolutionary "arms race" .

What is the genetic organization of the gtr operon in Shigella phages?

The gtr operon in Shigella phages typically consists of three genes: gtrA, gtrB, and gtrX (where X varies depending on the serotype). These genes are often arranged sequentially and are co-transcribed as a single polycistronic mRNA. Analysis of Shigella phage genomes reveals that:

  • The gtr operon is often located near tRNA genes, which can serve as integration sites for phages into the bacterial chromosome

  • Regulatory elements, including promoters and operators, are found upstream of the gtrA gene

  • The operon may be flanked by insertion sequences or other mobile genetic elements, suggesting horizontal gene transfer events

Based on comparative genomics studies, Shigella phages belonging to the Tunavirus genus show conservation in this operon structure, though there can be variations in the gtrX gene, which confers serotype specificity . To characterize the genetic organization, the following table represents typical features:

GeneSize (approx.)FunctionConservation across phages
gtrA400-500 bpTranslocase activityHigh
gtrB800-1000 bpGlucosyltransferaseHigh
gtrXVariableSerotype-specific transferaseLow

How is gtrA expression regulated during phage infection?

The regulation of gtrA expression during phage infection follows a tightly controlled temporal pattern that aligns with the phage lifecycle. Based on gene expression studies, several key regulatory mechanisms have been identified:

  • Temporal regulation: gtrA expression is typically initiated during the middle to late phase of phage infection, after the phage has established its replication machinery but before the assembly of new virions.

  • Transcriptional regulation: The gtr operon promoter may be recognized by phage-encoded RNA polymerase or host RNA polymerase with phage-encoded transcription factors.

  • Translational regulation: The presence of tRNA genes in Shigella phage genomes, including tRNA-Arg(tct), tRNA-Asn(gtt), and others, suggests that phages can modulate translation efficiency independently of the host machinery .

To study these regulatory mechanisms, researchers employ time-course qRT-PCR to measure transcript levels at different stages of infection, promoter-reporter fusion assays to identify regulatory elements, chromatin immunoprecipitation (ChIP) to detect protein-DNA interactions at the gtr promoter, and ribosome profiling to assess translational efficiency. Understanding this regulation is crucial for manipulating gtrA expression in recombinant systems and for predicting how serotype conversion might occur during natural phage infection.

What are the optimal conditions for expressing recombinant gtrA in laboratory settings?

Expressing recombinant gtrA presents unique challenges due to its membrane-associated nature. Optimal expression conditions must balance protein yield with proper folding and insertion into membranes. A comprehensive expression protocol should consider:

  • Expression system selection:

    • E. coli-based systems (BL21(DE3), C41/C43 for membrane proteins)

    • Cell-free expression systems for toxic membrane proteins

    • Yeast systems (P. pastoris) for complex glycosylation studies

  • Vector design considerations:

    • Fusion tags (His6, MBP, SUMO) to aid purification and solubility

    • Inducible promoters with tight regulation (T7, tac, tetO)

    • Signal sequences for proper membrane targeting

  • Growth and induction parameters:

    ParameterOptimization rangeMonitoring method
    Temperature16-30°CSDS-PAGE, Western blot
    Inducer concentration0.1-1.0 mM IPTGActivity assay
    Duration4-24 hoursTime-course sampling
    Media compositionLB, TB, minimal mediaGrowth curves

These parameters should be systematically optimized using design of experiments (DOE) approaches, which allow for efficient testing of multiple variables simultaneously to determine the most significant factors affecting expression . For membrane proteins like gtrA, lower temperatures (16-20°C) often improve proper folding, while the addition of glycerol or specific detergents to the growth medium can enhance stability.

How can I design experiments to study gtrA's role in phage-host interactions?

Designing experiments to study gtrA's role in phage-host interactions requires a multi-faceted approach that combines genetic manipulation, functional assays, and infection models. A comprehensive experimental design should include:

  • Genetic manipulation strategies:

    • Construction of gtrA knockout phages using CRISPR-Cas systems

    • Complementation with wild-type and mutant gtrA variants

    • Site-directed mutagenesis of conserved residues

    • Reporter gene fusions to monitor expression

  • Phage-host interaction assays:

    • Adsorption assays to measure phage attachment to bacterial cells

    • One-step growth curves to assess infection efficiency

    • Efficiency of plating (EOP) tests on different host strains

    • Competition assays between wild-type and modified phages

  • Structural and biochemical approaches:

    • In vitro translocase activity assays with purified components

    • Membrane vesicle studies to monitor glucose translocation

    • Cross-linking experiments to identify interaction partners

Following the principles of experimental design, researchers should implement a Resolution IV or V design to distinguish between main effects and two-way interactions . For 4-7 factors that might affect gtrA function, a minimum of 16-32 runs would be needed for a Resolution IV design, allowing for systematic exploration of multiple variables while maintaining experimental feasibility .

What methods are most effective for purifying recombinant gtrA protein?

Purifying recombinant gtrA protein requires specialized techniques due to its membrane-associated nature. The most effective purification strategy includes:

  • Membrane protein extraction:

    • Detergent screening (DDM, LDAO, OG, etc.) for optimal solubilization

    • Evaluation of detergent concentration and buffer composition

    • Alternative solubilization with amphipols or nanodiscs for stability

  • Chromatography sequence optimization:

    Purification stepTechniquePurposeElution conditions
    Initial captureIMAC (Ni-NTA)Affinity purification via His-tagImidazole gradient
    IntermediateIon exchangeCharge-based separationSalt gradient
    PolishingSize exclusionRemoval of aggregatesIsocratic
    SpecialtyLipid cubic phaseMaintaining native environmentDetergent gradient
  • Quality assessment methods:

    • SDS-PAGE and Western blotting to verify purity

    • Circular dichroism to assess secondary structure

    • Mass spectrometry for molecular weight confirmation

    • Dynamic light scattering for homogeneity analysis

The purification protocol should be optimized systematically, following design of experiments principles , to identify the critical factors affecting protein stability and activity. For membrane proteins like gtrA, maintaining the native-like membrane environment is often crucial for preserving functional activity after purification.

How can functional assays be designed to measure gtrA activity?

Designing functional assays to measure gtrA activity requires methods that can detect the translocation of glucosyl-bactoprenol across membranes. A comprehensive approach includes:

  • In vitro translocation assays:

    • Preparation of inside-out membrane vesicles containing recombinant gtrA

    • Synthesis of fluorescently-labeled glucosyl-bactoprenol substrates

    • Measurement of substrate translocation using fluorescence quenching or FRET

    • Controls with inactive gtrA mutants and competing substrates

  • Coupled enzyme assays:

    • Co-expression of gtrA with gtrB (glucosyltransferase)

    • Supply of UDP-glucose and bactoprenol substrates

    • Detection of glucosyl-bactoprenol production and translocation

    • Quantification via radioactive labeling or mass spectrometry

  • In vivo reporter systems:

    • Construction of bacterial strains with O-antigen modifications dependent on gtrA function

    • Development of serotype-specific antibodies for detection

    • Flow cytometry analysis of surface antigen expression

    • Phage sensitivity assays to detect functional O-antigen modification

The design of these assays should follow principles outlined in experimental design literature , with careful consideration of control experiments, replication levels, and statistical analysis methods. A fractional factorial design approach would be appropriate for optimizing assay conditions, allowing systematic exploration of multiple variables while minimizing the number of experiments required.

How do I interpret contradictory results in gtrA functional studies?

Interpreting contradictory results in gtrA functional studies requires a systematic approach to identify the sources of discrepancy and reconcile the findings. A methodological framework includes:

  • Systematic comparison of experimental conditions:

    • Create a detailed table comparing methodologies across studies

    • Identify key differences in expression systems, purification methods, and assay conditions

    • Evaluate the impact of membrane composition on gtrA functionality

    • Consider differences in protein tags, constructs, and expression levels

  • Validation through orthogonal approaches:

    • Implement multiple independent assay methods to measure the same parameter

    • Compare in vitro biochemical data with in vivo functional outcomes

    • Use structural biology approaches to complement functional studies

    • Apply evolutionary analysis to determine which results align with conserved functions

  • Statistical reevaluation:

    • Apply meta-analysis techniques to aggregate data across studies

    • Utilize analysis of variance (ANOVA) methods to identify significant factors

    • Implement screening experiments to determine which factors are causing variability in results

    • Conduct Resolution V experiments to evaluate two-way interactions between experimental factors

  • Hypothesis reconciliation strategies:

    Contradiction typeAnalysis approachResolution strategy
    Activity level discrepanciesNormalization to common standardsIdentify condition-dependent effects
    Substrate specificity differencesStructure-activity relationship analysisMap specificity determinants
    Mechanism disagreementsTime-resolved measurementsIdentify rate-limiting steps
    Physiological relevance conflictsIn vivo validation studiesContext-dependent model development

When analyzing contradictory results, it's important to consider that the Shigella phage-host interaction is part of a complex evolutionary "arms race" , where subtle changes in experimental conditions can significantly impact observed phenotypes.

What statistical approaches are most appropriate for analyzing gtrA activity data?

The analysis of gtrA activity data requires robust statistical approaches that account for the complex, multi-factorial nature of membrane protein function. Recommended statistical methodologies include:

  • Experimental design and analysis frameworks:

    • Factorial and fractional factorial designs to efficiently explore multiple factors

    • Response surface methodology to optimize conditions for maximal activity

    • Analysis of variance (ANOVA) to determine significant factors affecting activity

    • Regression analysis to model relationships between experimental variables and activity

  • Kinetic data analysis approaches:

    • Michaelis-Menten kinetics fitting for substrate concentration dependencies

    • Global fitting of multiple datasets to constrain complex models

    • Bayesian parameter estimation for robust handling of uncertainty

    • Bootstrap methods to estimate confidence intervals

  • Comparative analyses across conditions:

    • Mixed-effects models to account for batch-to-batch variability

    • Multiple comparison corrections (e.g., Bonferroni, Tukey HSD) for hypothesis testing

    • Non-parametric methods for non-normally distributed data

    • Power analysis to determine required sample sizes for detecting effects

When designing experiments to study gtrA activity, researchers should consider the minimum number of runs needed for Resolution IV and V designs as outlined in reference , which provides guidance on efficiently exploring multiple factors while maintaining statistical power.

How can bioinformatic tools help predict gtrA protein structure and function?

Bioinformatic tools provide powerful approaches for predicting gtrA protein structure and function, especially when experimental determination of membrane protein structures remains challenging. A comprehensive bioinformatic pipeline includes:

  • Sequence-based analysis:

    • Multiple sequence alignment to identify conserved residues using MUSCLE or MAFFT

    • Transmembrane topology prediction using TMHMM, TOPCONS, or Phobius

    • Detection of functional domains and motifs using InterProScan

    • Evolutionary analysis to identify positively selected residues

  • Structure prediction approaches:

    • Ab initio modeling with specialized membrane protein servers (MEMOIR, LOMETS)

    • Template-based modeling when homologous structures exist

    • AlphaFold2 or RoseTTAFold for accurate deep learning-based prediction

    • Molecular dynamics simulations to refine models in membrane environments

  • Functional annotation methods:

    • Gene neighborhood analysis to identify functional associations

    • Co-evolution analysis to detect interacting residues

    • Molecular docking to predict substrate binding sites

    • Virtual screening to identify potential inhibitors

  • Integrated analysis workflows:

    Analysis goalTool combinationOutput formatValidation approach
    Membrane topologyTMHMM + TOPCONS + PredictProtein2D topology mapExperimental accessibility assays
    3D structureAlphaFold + AMBER MD in membranePDB fileCross-linking data comparison
    Substrate specificityConSurf + AutoDock + MDBinding energy tableMutagenesis validation
    Evolutionary historyPAML + FEL + MEMESelection pressure mapComparative biochemistry

These bioinformatic approaches can be particularly valuable for understanding how gtrA contributes to phage evolution and adaptation to bacterial resistance , helping to identify key residues that might be involved in the co-evolutionary arms race between Shigella and its phages.

What are the implications of gtrA polymorphisms for phage-host specificity?

The implications of gtrA polymorphisms for phage-host specificity reflect the complex co-evolutionary dynamics between Shigella phages and their bacterial hosts. A comprehensive analysis reveals:

  • Molecular basis of specificity determinants:

    • Structure-function mapping of polymorphic residues

    • Correlation between gtrA sequence variants and host range

    • Effect of polymorphisms on substrate recognition and processing

    • Interaction between gtrA variants and bacterial membrane composition

  • Evolutionary patterns and selective pressures:

    • Identification of rapidly evolving regions within gtrA sequences

    • Correlation with bacterial resistance mechanisms

    • Evidence of balancing selection maintaining polymorphism

    • Geographic and temporal distribution of gtrA variants

  • Functional consequences of polymorphisms:

    Polymorphism locationFunctional effectDetection methodHost range impact
    Substrate binding siteAltered specificityBinding assaysSerotype restriction
    Membrane interaction domainChanged membrane localizationFractionation studiesHost adaptation
    Catalytic residuesModified activity levelKinetic assaysEfficiency differences
    Protein-protein interaction sitesAltered complex formationCo-IP/crosslinkingHost factor dependence

This research area is particularly relevant given the importance of understanding phage-host interactions for developing effective phage therapy against antibiotic-resistant Shigella strains , where the modification of bacterial surface antigens can significantly impact phage infection dynamics.

How does gtrA contribute to phage evolution and adaptation to bacterial resistance?

The gtrA gene plays a crucial role in phage evolution and adaptation to bacterial resistance through several mechanisms that reflect the ongoing co-evolutionary "arms race" between Shigella phages and their bacterial hosts . Key aspects include:

  • Evolutionary mechanisms driving gtrA diversification:

    • Horizontal gene transfer between phages, evidenced by comparative genomics

    • Recombination events creating mosaic gtr operons

    • Positive selection on specific residues countering bacterial defense innovations

    • Modular evolution where different domains evolve at different rates

  • Functional adaptations to overcome bacterial resistance:

    • Modification of O-antigen recognition to counter receptor alterations

    • Adaptations to variations in bacterial membrane composition

    • Co-evolution with gtrB and gtrX to maintain functional compatibility

    • Development of mechanisms to evade bacterial CRISPR-Cas and restriction-modification systems

  • Experimental evidence of adaptation pathways:

    Resistance mechanismgtrA adaptationDetection methodEvolutionary signature
    Receptor modificationAltered substrate specificityHost range analysisAccelerated substitution rates
    Membrane composition changesModified membrane interactionsLipid binding assaysConvergent evolution
    Inhibitory proteinsStructural changes to avoid bindingProtein interaction studiesEpisodic selection
    CRISPR targetingSilent mutations preserving functionSequence analysisSynonymous variation

Understanding these evolutionary dynamics is essential for developing effective phage-based approaches against antibiotic-resistant Shigella infections , particularly in light of the growing public health challenge posed by multi-drug resistant strains.

What is the potential for using gtrA-based systems in phage therapy against antibiotic-resistant Shigella?

The potential for using gtrA-based systems in phage therapy against antibiotic-resistant Shigella represents an innovative approach to address the growing public health challenge of antimicrobial resistance . A comprehensive analysis reveals several promising strategies:

  • Therapeutic application frameworks:

    • Engineering phages with modified gtrA to expand host range

    • Development of phage cocktails targeting different serotypes

    • Creation of synthetic phages with optimized gtrA variants

    • Design of gtrA inhibitors as adjuvants to conventional antibiotics

  • Resistance management strategies:

    • Evolutionary modeling to predict resistance development

    • Implementation of cycling or combination therapy approaches

    • Creation of self-adapting phage systems through directed evolution

    • Development of multi-target approaches addressing multiple bacterial vulnerabilities

  • Clinical development considerations:

    Application approachAdvantagesChallengesDevelopment status
    Natural phage cocktailsImmediate availabilityLimited engineeringEarly clinical trials
    Engineered phagesExpanded host rangeRegulatory hurdlesPreclinical development
    Synthetic biology approachesPrecise controlSafety concernsBasic research
    Combination with antibioticsSynergistic effectsInteraction complexityEarly clinical testing

The development of phage therapy approaches targeting Shigella is particularly timely given the "serious threat to global health" posed by antibiotic-resistant strains , especially in low- and middle-income countries where shigellosis remains a significant cause of morbidity and mortality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.