Recombinant Shigella sonnei 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Shigella sonnei 4-hydroxybenzoate octaprenyltransferase (UbiA) is a genetically engineered enzyme critical for ubiquinone (coenzyme Q) biosynthesis. This membrane-bound protein catalyzes the prenylation of 4-hydroxybenzoate (4-HB) with an octaprenyl group, forming 3-octaprenyl-4-hydroxybenzoate, a key intermediate in the ubiquinone pathway . Produced via heterologous expression in Escherichia coli, this recombinant protein is widely utilized in biochemical and structural studies .

Recombinant Production

Recombinant UbiA is synthesized in E. coli expression systems with the following standardized protocols :

ParameterSpecification
Expression HostEscherichia coli (BL21 or similar strains)
Tag SystemN-terminal 10xHis-tag for affinity chromatography
Purity>90% (SDS-PAGE verified)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (short-term); -80°C (long-term); avoid freeze-thaw cycles

Biochemical Properties

UbiA functions as a polyprenyltransferase (EC 2.5.1.-) with the following catalytic activity :

4-Hydroxybenzoate + Octaprenyl diphosphate3-Octaprenyl-4-hydroxybenzoate + Diphosphate\text{4-Hydroxybenzoate + Octaprenyl diphosphate} \rightarrow \text{3-Octaprenyl-4-hydroxybenzoate + Diphosphate}
  • Substrate Specificity: Requires divalent cations (e.g., Mg²⁺) for activity .

  • Kinetic Parameters: KmK_m values for 4-HB and octaprenyl diphosphate remain to be fully characterized in S. sonnei.

Research Applications

This recombinant protein is pivotal in:

  • Enzyme Mechanism Studies: Elucidating prenylation kinetics and membrane-associated catalysis .

  • Drug Discovery: Screening inhibitors targeting ubiquinone biosynthesis in pathogenic bacteria .

  • Structural Biology: Cryo-EM or crystallography to resolve transmembrane domain architecture .

Significance in Microbial Physiology

UbiA is indispensable for S. sonnei aerobic respiration, as ubiquinone is a vital electron transporter. Its role extends beyond metabolism:

  • Virulence Link: Indirectly supports pathogen survival by maintaining energy homeostasis during infection .

  • Antibiotic Resistance: Ubiquinone deficiency sensitizes bacteria to oxidative stress, highlighting UbiA as a potential therapeutic target .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Important: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ubiA; SSON_4220; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
ubiA
Target Protein Sequence
MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. It mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis, which involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of 4-hydroxybenzoate octaprenyltransferase (ubiA) in Shigella sonnei?

4-hydroxybenzoate octaprenyltransferase (ubiA) is an essential enzyme in the ubiquinone (coenzyme Q) biosynthesis pathway in Shigella sonnei. It catalyzes the transfer of a polyprenyl group to 4-hydroxybenzoate, a critical step in the production of ubiquinone, which functions in the bacterial electron transport chain. The enzyme plays a crucial role in cellular respiration and energy production in this pathogenic bacterium. The protein is also referred to as 4-HB polyprenyltransferase in some literature .

How is recombinant Shigella sonnei ubiA typically expressed and purified for research purposes?

Recombinant Shigella sonnei ubiA is commonly expressed in Escherichia coli expression systems. The gene encoding the protein is cloned into a suitable expression vector with an N-terminal histidine tag (His-tag) to facilitate purification. After expression, the protein is typically purified through affinity chromatography using nickel or cobalt resins that bind to the His-tag . The purified protein is generally obtained as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE. The recombinant protein may be stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

How does Shigella sonnei ubiA compare structurally with its homolog in Shigella boydii?

Interestingly, Shigella sonnei and Shigella boydii serotype 18 share identical ubiA protein sequences, as evidenced by the following alignment:

SpeciesAmino Acid Sequence (1-290)UniProt ID
S. sonneiMEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYYWS ILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHFQ3YUU4
S. boydiiMEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYYWS ILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHFB2TX76

This complete sequence conservation suggests strong evolutionary pressure to maintain the structure and function of this enzyme across these closely related Shigella species .

What are the optimal expression conditions for obtaining soluble recombinant Shigella sonnei ubiA protein?

Obtaining soluble recombinant membrane proteins like ubiA can be challenging. Based on successful approaches with similar proteins, researchers should consider the following strategies:

  • Expression strain selection: BL21(DE3), C41(DE3), or C43(DE3) E. coli strains which are engineered for membrane protein expression

  • Temperature optimization: Lower induction temperatures (16-20°C) often increase solubility

  • Induction protocol: Using lower IPTG concentrations (0.1-0.5 mM) and longer induction times

  • Media supplementation: Addition of glycerol (0.5-2%) to culture media can improve membrane protein folding

  • Detergent selection: Initial screening of multiple detergents (DDM, LDAO, or OG) for solubilization

These approaches parallel those used successfully for other Shigella recombinant proteins . Researchers have previously encountered similar challenges with invasion plasmid antigens (Ipa) from Shigella flexneri, where modifications of bacterial growth conditions and alternative plasmid expression vectors were crucial for obtaining soluble protein .

What methodological approaches can be used to study the enzymatic activity of recombinant Shigella sonnei ubiA?

The enzymatic activity of recombinant ubiA can be assessed through several complementary approaches:

  • Radioisotope-based assay: Measuring the incorporation of radiolabeled prenyl groups into 4-hydroxybenzoate

  • HPLC analysis: Monitoring substrate depletion and product formation

  • Coupled enzyme assays: Linking ubiA activity to a detectable enzymatic reaction

  • Reconstitution in liposomes: Incorporating purified ubiA into artificial membrane systems to mimic native conditions

For accurate kinetic characterization, researchers should:

  • Optimize detergent concentration to maintain protein stability without inhibiting activity

  • Test various divalent cations (Mg²⁺, Mn²⁺) as potential cofactors

  • Carefully control pH and temperature to determine optimal reaction conditions

  • Consider the hydrophobic nature of both substrate and product in assay design

How can recombinant Shigella sonnei ubiA be used to investigate bacterial pathogenesis?

Recombinant Shigella sonnei ubiA can serve as a valuable tool in pathogenesis research through several approaches:

  • Structure-function studies: Site-directed mutagenesis of recombinant ubiA can help identify critical residues for enzymatic activity and bacterial viability

  • Inhibitor screening: The purified protein enables high-throughput screening for specific inhibitors that could serve as potential antibacterial compounds

  • Immunological investigations: Purified ubiA can be used to raise antibodies for detecting the native protein during infection or to study host immune responses

  • Metabolic pathway analysis: Combining ubiA studies with other ubiquinone biosynthesis enzymes can reveal pathway vulnerabilities specific to Shigella

These approaches are particularly relevant given the rising antibiotic resistance observed in Shigella species and the urgent need for new therapeutic targets .

How does the study of ubiA relate to broader vaccine development strategies against Shigella?

While ubiA itself is not typically a direct vaccine target, research on recombinant Shigella proteins has contributed significantly to vaccine development strategies. Recent advances in Shigella vaccine development include:

  • Recombinant protein approaches: Similar to ubiA expression, researchers have successfully expressed and purified invasion plasmid antigens (IpaB, IpaC, and IpaD) from Shigella flexneri using E. coli expression systems . These purified proteins have been valuable for:

    • Exploring host immune responses to Shigella invasion

    • Elucidating pathogen internalization mechanisms

    • Analyzing protein complexes involved in host cell invasion

    • Monitoring efficacy of live oral vaccines in human trials

  • Innovative vaccine platforms: Recent studies have developed recombinant Shigella flexneri strains expressing heterologous antigens, such as the heat-labile enterotoxin B (LTB) from enterotoxigenic Escherichia coli (ETEC) . This approach aims to provide cross-protection against multiple enteric pathogens, demonstrating how recombinant protein technology in Shigella has advanced beyond single protein studies to complex vaccine design .

What are the primary challenges in maintaining stability of purified recombinant Shigella sonnei ubiA?

Membrane proteins like ubiA present several stability challenges after purification:

  • Aggregation issues: ubiA tends to aggregate in solution due to exposed hydrophobic surfaces

  • Detergent considerations: Finding the optimal detergent type and concentration is critical

  • Buffer optimization: The recommended storage buffer (Tris/PBS-based with 6% trehalose, pH 8.0) helps maintain stability

  • Storage recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to prevent repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

What analytical methods are most effective for verifying the structural integrity of recombinant Shigella sonnei ubiA?

To verify the structural integrity of purified recombinant ubiA, researchers should consider:

  • SDS-PAGE analysis: Standard for purity assessment (>90% purity is typically achievable)

  • Western blotting: Using anti-His antibodies to confirm the presence of the His-tagged protein

  • Circular dichroism (CD): To evaluate secondary structure content and proper folding

  • Size exclusion chromatography: To assess oligomeric state and detect aggregation

  • Thermal shift assays: To evaluate protein stability under various buffer conditions

  • Limited proteolysis: To verify the protein's folded state by resistance to proteolytic degradation

Researchers should note that membrane proteins require special considerations during these analyses, particularly regarding detergent compatibility with the analytical method chosen.

How might structural studies of Shigella sonnei ubiA contribute to antimicrobial development?

Structural studies of Shigella sonnei ubiA could contribute to antimicrobial development in several ways:

  • Target-based drug design: Detailed structural information could enable the rational design of specific inhibitors targeting the active site of ubiA

  • Comparative structural analysis: Identifying structural differences between bacterial and human homologs could lead to selectively targeting the bacterial enzyme

  • Allosteric site identification: Structural studies may reveal allosteric sites that could be targeted by small molecules to modulate enzyme activity

  • Structure-guided fragment screening: Using structural information to guide fragment-based drug discovery approaches

These approaches are particularly relevant in light of the limited number of genes that show differential essentiality between closely related bacterial species like Shigella and E. coli, as highlighted in comparative genomic studies .

What novel methodological approaches are being developed for studying membrane proteins like ubiA?

Several cutting-edge methodologies are advancing the study of challenging membrane proteins like ubiA:

  • Nanodiscs and SMALPs (styrene-maleic acid lipid particles): Novel membrane mimetics that maintain a native-like lipid environment for membrane proteins without conventional detergents

  • Single-particle cryo-electron microscopy (cryo-EM): Enabling structural determination of membrane proteins without crystallization

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Providing insights into protein dynamics and ligand interactions

  • Microfluidic approaches: Enabling high-throughput screening of buffer and detergent conditions for optimal stability

  • Cell-free expression systems: Alternative to in vivo expression, potentially offering advantages for toxic or poorly expressed membrane proteins

These methodological innovations are expanding the toolkit available for researchers working with challenging membrane proteins like ubiA, potentially accelerating discoveries in this field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.