Recombinant Shigella sonnei 4-hydroxybenzoate octaprenyltransferase (UbiA) is a genetically engineered enzyme critical for ubiquinone (coenzyme Q) biosynthesis. This membrane-bound protein catalyzes the prenylation of 4-hydroxybenzoate (4-HB) with an octaprenyl group, forming 3-octaprenyl-4-hydroxybenzoate, a key intermediate in the ubiquinone pathway . Produced via heterologous expression in Escherichia coli, this recombinant protein is widely utilized in biochemical and structural studies .
Recombinant UbiA is synthesized in E. coli expression systems with the following standardized protocols :
UbiA functions as a polyprenyltransferase (EC 2.5.1.-) with the following catalytic activity :
Substrate Specificity: Requires divalent cations (e.g., Mg²⁺) for activity .
Kinetic Parameters: values for 4-HB and octaprenyl diphosphate remain to be fully characterized in S. sonnei.
This recombinant protein is pivotal in:
Enzyme Mechanism Studies: Elucidating prenylation kinetics and membrane-associated catalysis .
Drug Discovery: Screening inhibitors targeting ubiquinone biosynthesis in pathogenic bacteria .
Structural Biology: Cryo-EM or crystallography to resolve transmembrane domain architecture .
UbiA is indispensable for S. sonnei aerobic respiration, as ubiquinone is a vital electron transporter. Its role extends beyond metabolism:
KEGG: ssn:SSON_4220
4-hydroxybenzoate octaprenyltransferase (ubiA) is an essential enzyme in the ubiquinone (coenzyme Q) biosynthesis pathway in Shigella sonnei. It catalyzes the transfer of a polyprenyl group to 4-hydroxybenzoate, a critical step in the production of ubiquinone, which functions in the bacterial electron transport chain. The enzyme plays a crucial role in cellular respiration and energy production in this pathogenic bacterium. The protein is also referred to as 4-HB polyprenyltransferase in some literature .
Recombinant Shigella sonnei ubiA is commonly expressed in Escherichia coli expression systems. The gene encoding the protein is cloned into a suitable expression vector with an N-terminal histidine tag (His-tag) to facilitate purification. After expression, the protein is typically purified through affinity chromatography using nickel or cobalt resins that bind to the His-tag . The purified protein is generally obtained as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE. The recombinant protein may be stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .
Interestingly, Shigella sonnei and Shigella boydii serotype 18 share identical ubiA protein sequences, as evidenced by the following alignment:
| Species | Amino Acid Sequence (1-290) | UniProt ID |
|---|---|---|
| S. sonnei | MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYYWS ILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF | Q3YUU4 |
| S. boydii | MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTILLSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWAVAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYYWS ILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF | B2TX76 |
This complete sequence conservation suggests strong evolutionary pressure to maintain the structure and function of this enzyme across these closely related Shigella species .
Obtaining soluble recombinant membrane proteins like ubiA can be challenging. Based on successful approaches with similar proteins, researchers should consider the following strategies:
Expression strain selection: BL21(DE3), C41(DE3), or C43(DE3) E. coli strains which are engineered for membrane protein expression
Temperature optimization: Lower induction temperatures (16-20°C) often increase solubility
Induction protocol: Using lower IPTG concentrations (0.1-0.5 mM) and longer induction times
Media supplementation: Addition of glycerol (0.5-2%) to culture media can improve membrane protein folding
Detergent selection: Initial screening of multiple detergents (DDM, LDAO, or OG) for solubilization
These approaches parallel those used successfully for other Shigella recombinant proteins . Researchers have previously encountered similar challenges with invasion plasmid antigens (Ipa) from Shigella flexneri, where modifications of bacterial growth conditions and alternative plasmid expression vectors were crucial for obtaining soluble protein .
The enzymatic activity of recombinant ubiA can be assessed through several complementary approaches:
Radioisotope-based assay: Measuring the incorporation of radiolabeled prenyl groups into 4-hydroxybenzoate
HPLC analysis: Monitoring substrate depletion and product formation
Coupled enzyme assays: Linking ubiA activity to a detectable enzymatic reaction
Reconstitution in liposomes: Incorporating purified ubiA into artificial membrane systems to mimic native conditions
For accurate kinetic characterization, researchers should:
Optimize detergent concentration to maintain protein stability without inhibiting activity
Test various divalent cations (Mg²⁺, Mn²⁺) as potential cofactors
Carefully control pH and temperature to determine optimal reaction conditions
Consider the hydrophobic nature of both substrate and product in assay design
Recombinant Shigella sonnei ubiA can serve as a valuable tool in pathogenesis research through several approaches:
Structure-function studies: Site-directed mutagenesis of recombinant ubiA can help identify critical residues for enzymatic activity and bacterial viability
Inhibitor screening: The purified protein enables high-throughput screening for specific inhibitors that could serve as potential antibacterial compounds
Immunological investigations: Purified ubiA can be used to raise antibodies for detecting the native protein during infection or to study host immune responses
Metabolic pathway analysis: Combining ubiA studies with other ubiquinone biosynthesis enzymes can reveal pathway vulnerabilities specific to Shigella
These approaches are particularly relevant given the rising antibiotic resistance observed in Shigella species and the urgent need for new therapeutic targets .
While ubiA itself is not typically a direct vaccine target, research on recombinant Shigella proteins has contributed significantly to vaccine development strategies. Recent advances in Shigella vaccine development include:
Recombinant protein approaches: Similar to ubiA expression, researchers have successfully expressed and purified invasion plasmid antigens (IpaB, IpaC, and IpaD) from Shigella flexneri using E. coli expression systems . These purified proteins have been valuable for:
Innovative vaccine platforms: Recent studies have developed recombinant Shigella flexneri strains expressing heterologous antigens, such as the heat-labile enterotoxin B (LTB) from enterotoxigenic Escherichia coli (ETEC) . This approach aims to provide cross-protection against multiple enteric pathogens, demonstrating how recombinant protein technology in Shigella has advanced beyond single protein studies to complex vaccine design .
Membrane proteins like ubiA present several stability challenges after purification:
Aggregation issues: ubiA tends to aggregate in solution due to exposed hydrophobic surfaces
Detergent considerations: Finding the optimal detergent type and concentration is critical
Buffer optimization: The recommended storage buffer (Tris/PBS-based with 6% trehalose, pH 8.0) helps maintain stability
Storage recommendations:
To verify the structural integrity of purified recombinant ubiA, researchers should consider:
SDS-PAGE analysis: Standard for purity assessment (>90% purity is typically achievable)
Western blotting: Using anti-His antibodies to confirm the presence of the His-tagged protein
Circular dichroism (CD): To evaluate secondary structure content and proper folding
Size exclusion chromatography: To assess oligomeric state and detect aggregation
Thermal shift assays: To evaluate protein stability under various buffer conditions
Limited proteolysis: To verify the protein's folded state by resistance to proteolytic degradation
Researchers should note that membrane proteins require special considerations during these analyses, particularly regarding detergent compatibility with the analytical method chosen.
Structural studies of Shigella sonnei ubiA could contribute to antimicrobial development in several ways:
Target-based drug design: Detailed structural information could enable the rational design of specific inhibitors targeting the active site of ubiA
Comparative structural analysis: Identifying structural differences between bacterial and human homologs could lead to selectively targeting the bacterial enzyme
Allosteric site identification: Structural studies may reveal allosteric sites that could be targeted by small molecules to modulate enzyme activity
Structure-guided fragment screening: Using structural information to guide fragment-based drug discovery approaches
These approaches are particularly relevant in light of the limited number of genes that show differential essentiality between closely related bacterial species like Shigella and E. coli, as highlighted in comparative genomic studies .
Several cutting-edge methodologies are advancing the study of challenging membrane proteins like ubiA:
Nanodiscs and SMALPs (styrene-maleic acid lipid particles): Novel membrane mimetics that maintain a native-like lipid environment for membrane proteins without conventional detergents
Single-particle cryo-electron microscopy (cryo-EM): Enabling structural determination of membrane proteins without crystallization
Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Providing insights into protein dynamics and ligand interactions
Microfluidic approaches: Enabling high-throughput screening of buffer and detergent conditions for optimal stability
Cell-free expression systems: Alternative to in vivo expression, potentially offering advantages for toxic or poorly expressed membrane proteins
These methodological innovations are expanding the toolkit available for researchers working with challenging membrane proteins like ubiA, potentially accelerating discoveries in this field.