Recombinant Shigella sonnei ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
atpF; SSON_3883; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, encompassing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel, forming part of the peripheral stalk that connects F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is ATP synthase subunit b (atpF) in Shigella sonnei?

ATP synthase subunit b (atpF) in Shigella sonnei is a membrane protein component of the F₀ sector of the F-type ATP synthase complex. This protein plays a crucial structural role in the enzyme complex that catalyzes ATP synthesis during oxidative phosphorylation. In Shigella sonnei strain Ss046, atpF is encoded by the SSON_3883 gene . The protein consists of 156 amino acids with a sequence that includes a membrane-spanning region and a cytoplasmic domain that interacts with other ATP synthase components . The protein is highly conserved among gram-negative bacteria, reflecting its essential role in energy metabolism. ATP synthase subunit b functions as a peripheral stalk connecting the F₁ catalytic sector to the membrane-embedded F₀ sector, helping to maintain the structural integrity of the complex during rotational catalysis.

What are the structural characteristics of Shigella sonnei atpF?

The Shigella sonnei ATP synthase subunit b is a 156-amino acid protein with a characteristic structure common to F-type ATP synthases. Based on the amino acid sequence data, the protein contains a hydrophobic N-terminal region (approximately residues 1-25) that anchors it to the membrane, followed by a predominantly hydrophilic domain that extends into the cytoplasm . The complete amino acid sequence is: MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKASATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREELRKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL . Structural predictions suggest that the cytoplasmic portion forms an extended α-helical domain that interacts with the δ and α subunits of the F₁ sector. The protein likely forms a homodimer in the functional ATP synthase complex, creating a rigid connection between the membrane-embedded proton channel and the catalytic components. This structural arrangement is critical for the coupling of proton translocation to ATP synthesis.

What are the optimal conditions for expressing recombinant S. sonnei atpF?

Optimal expression of recombinant Shigella sonnei ATP synthase subunit b requires careful consideration of expression systems and conditions. Based on protocols for similar membrane proteins, the following methodological approach is recommended:

Expression System Selection:

  • E. coli BL21(DE3) or C43(DE3) strains are preferred for membrane protein expression

  • Vector systems with tunable expression (e.g., pET vectors with T7 promoters) allow controlled induction

Expression Conditions:

ParameterOptimal ConditionRationale
Induction temperature16-20°CReduces inclusion body formation
IPTG concentration0.1-0.5 mMLower concentrations reduce toxicity
Culture density at inductionOD₆₀₀ 0.6-0.8Balances cell density and metabolic state
Post-induction time16-20 hoursAllows sufficient protein accumulation
Media supplements1% glucosePrevents leaky expression

For membrane proteins like atpF, consider using strategies to enhance membrane integration, such as co-expression with chaperones or fusion to solubility tags that can be later removed. The hydrophobic N-terminal region of atpF may present challenges during expression, potentially requiring detergents or specialized solubilization methods during purification. Alternative approaches include expressing only the soluble domain or using specialized membrane protein expression systems.

What purification strategies are most effective for recombinant atpF?

Purification of recombinant Shigella sonnei ATP synthase subunit b requires specialized approaches due to its membrane-associated nature. A comprehensive purification strategy would include:

Membrane Extraction:

  • Cell lysis using French press or sonication in buffer containing protease inhibitors

  • Membrane fraction isolation via differential centrifugation

  • Detergent solubilization using mild detergents (e.g., DDM, LDAO, or C₁₂E₈)

Chromatographic Purification:

Purification StepMethodBuffer Conditions
Initial captureIMAC (for His-tagged protein)50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% DDM
Intermediate purificationIon exchange chromatography20 mM HEPES pH 7.4, 0-500 mM NaCl gradient, 0.05% DDM
PolishingSize exclusion chromatography20 mM Tris-HCl pH 7.5, 100 mM NaCl, 0.03% DDM

As indicated in the product information, purified recombinant atpF is optimally stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage . Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . Verification of purified protein can be performed using SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity.

How can researchers assess the functionality of purified atpF?

Assessing the functionality of purified Shigella sonnei ATP synthase subunit b requires both direct and indirect approaches, as the b subunit itself does not possess enzymatic activity but contributes to the function of the ATP synthase complex. The following methodological approaches are recommended:

Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure content

  • Limited proteolysis to verify proper folding

  • Thermal shift assays to determine protein stability

Functional Assays:

Assay TypeMethodologyExpected Results
Binding assaysSurface plasmon resonance with ATP synthase δ subunitNanomolar affinity for properly folded atpF
Reconstitution studiesIncorporation into liposomes with other ATP synthase subunitsRestoration of ATP synthesis activity
Complementation assaysExpression in atpF-deficient bacterial strainsRescue of growth phenotypes

For a more comprehensive functional assessment, researchers could reconstitute the entire ATP synthase complex using purified components and measure ATP synthesis activity. This approach would involve incorporation of all subunits into liposomes with an established proton gradient, followed by monitoring ATP production using luciferase-based assays or other ATP detection methods. While technically challenging, this approach provides the most direct evidence of functional integration of atpF into the ATP synthase complex.

How does atpF contribute to Shigella sonnei virulence?

While ATP synthase is primarily associated with energy metabolism rather than virulence, emerging evidence suggests potential connections between bacterial energetics and pathogenicity. In the context of Shigella sonnei, the relationship between atpF and virulence can be examined from several perspectives:

Metabolic Support for Virulence:
The ATP synthase complex, including atpF, generates ATP necessary for powering virulence mechanisms such as the type III secretion system (T3SS). The T3SS in Shigella requires ATP hydrolysis by Spa47, a specialized ATPase, to inject effector proteins into host cells and establish infection . Studies have shown that ATP hydrolysis is essential for T3SS apparatus formation and proper translocator secretion profile in Shigella . While atpF is not directly involved in the T3SS, its role in ATP generation could indirectly support these virulence mechanisms.

Adaptation to Host Environments:
During infection, Shigella encounters various microenvironments with different pH levels and nutrient availability. The ATP synthase complex may play a role in adaptation to these environments by maintaining ATP levels under stress conditions. Research on related pathogens suggests that modulation of ATP synthase activity can contribute to acid tolerance and survival within macrophages.

Although direct evidence linking atpF specifically to Shigella virulence is limited, researchers could investigate this relationship through:

  • Creation of conditional atpF mutants to assess effects on virulence in cell culture and animal models

  • Transcriptomic analysis to determine if atpF expression changes during different stages of infection

  • Evaluation of atpF interaction with known virulence regulators

What structural features distinguish atpF from Shigella compared to other bacterial pathogens?

Comparative analysis of ATP synthase subunit b across different bacterial pathogens reveals both conserved features and species-specific adaptations. For Shigella sonnei atpF:

Sequence Comparison Analysis:

OrganismSequence Identity to S. sonnei atpFKey Differences
E. coli>99%Nearly identical due to close evolutionary relationship
Salmonella enterica~95%Minor variations in C-terminal domain
Pseudomonas aeruginosa~70%Differences in membrane-spanning region
Mycobacterium tuberculosis~35%Substantial differences in length and composition

Structural studies of ATP synthases from various bacteria suggest that these minor sequence variations can affect:

  • The stability of subunit interactions within the complex

  • The efficiency of energy coupling between proton translocation and ATP synthesis

  • Regulatory mechanisms controlling ATP synthase activity

These differences could potentially be exploited for the development of species-specific inhibitors targeting Shigella sonnei ATP synthase as a therapeutic approach.

How can atpF be exploited as a target for antimicrobial development?

ATP synthase has emerged as a promising target for antimicrobial development due to its essential role in bacterial energy metabolism. For Shigella sonnei atpF specifically, several strategic approaches could be considered:

Target Validation Approaches:

  • Generate conditional knockdown strains to confirm essentiality under various growth conditions

  • Perform in silico docking studies to identify potential binding sites

  • Evaluate existing ATP synthase inhibitors against Shigella sonnei

Drug Development Strategies:

ApproachMethodologyPotential Advantages
Small molecule inhibitorsHigh-throughput screening against purified atpFDirect targeting of protein structure
Peptide mimeticsDesign based on interaction interfacesPotentially higher specificity
Allosteric modulatorsTarget regulatory sitesMay allow selective inhibition
Antibody-based therapeuticsGenerate antibodies against exposed epitopesHigh specificity for bacterial target
  • The unique interface between atpF and other bacterial-specific subunits

  • Specific amino acid sequences in the membrane-spanning region

  • Differential accessibility of certain domains in the bacterial versus human enzyme

Successful inhibition of ATP synthase would potentially disrupt Shigella sonnei energy metabolism, leading to growth inhibition or cell death, thus representing a novel antimicrobial approach for this increasingly drug-resistant pathogen.

What experimental approaches can be used to study atpF interactions with other ATP synthase subunits?

Understanding the interactions between ATP synthase subunit b (atpF) and other components of the ATP synthase complex is crucial for elucidating the structure-function relationship of this essential enzyme. The following methodological approaches can be employed:

Protein-Protein Interaction Methods:

TechniqueApplicationExpected Outcomes
Crosslinking coupled with mass spectrometryIdentify interacting residuesSpecific amino acids at interaction interfaces
Co-immunoprecipitationConfirm interactions in vivoVerification of physiologically relevant interactions
Yeast two-hybrid or bacterial two-hybridScreen for interaction partnersIdentification of direct protein-protein interactions
Surface plasmon resonanceMeasure binding kineticsQuantitative affinity and kinetic parameters
FRET/BRETMonitor interactions in living cellsReal-time dynamics of complex formation

For a comprehensive analysis, researchers should consider combining multiple approaches. For instance, initial identification of interaction partners through crosslinking or co-immunoprecipitation can be followed by more detailed characterization using biophysical methods.

Design Considerations:

  • Include appropriate controls (non-interacting proteins, mutated interfaces)

  • Consider membrane environment for transmembrane domain interactions

  • Use detergents or nanodiscs to maintain native-like conditions for membrane proteins

  • Implement both tagged and untagged protein versions to confirm tag independence

By systematically mapping the interactions of atpF with other ATP synthase subunits, researchers can develop a detailed model of complex assembly and identify critical residues that could serve as targets for structure-based drug design.

How can site-directed mutagenesis be used to identify critical residues in atpF function?

Site-directed mutagenesis represents a powerful approach for identifying functionally important residues in Shigella sonnei ATP synthase subunit b. A comprehensive mutagenesis strategy would include:

Target Selection Strategy:

  • Conserved residues identified through multiple sequence alignment

  • Residues predicted to be at subunit interfaces based on homology modeling

  • Charged residues in the cytoplasmic domain that may participate in salt bridges

  • Hydrophobic residues in the membrane-spanning region

Experimental Design Framework:

Similar approaches have been successfully employed in studying ATPases in the Shigella T3SS. For example, research on Spa47, a T3SS ATPase, demonstrated how point mutations targeting predicted active site residues (K165A, E188A, and R350A) affected ATP hydrolysis while maintaining the global protein structure . These studies revealed that while the mutations did not prevent oligomerization, they completely abolished ATPase activity, highlighting the specific roles of these residues in catalysis rather than protein folding or assembly .

By applying similar methodologies to atpF, researchers can distinguish between residues critical for structural integrity versus those specifically involved in functional interactions with other ATP synthase subunits or in the mechanical coupling necessary for energy transduction.

What approaches can be used to study the role of atpF in the context of complete ATP synthase function?

Investigating the role of ATP synthase subunit b in the context of the complete ATP synthase complex requires approaches that preserve the native structure and function of the multi-subunit enzyme. The following methodologies are recommended:

In Vitro Reconstitution Approaches:

  • Purify individual ATP synthase components including atpF

  • Reconstitute the complex in liposomes or nanodiscs

  • Measure ATP synthesis/hydrolysis activity under varying conditions

  • Compare wild-type atpF with mutant variants

Genetic Complementation Studies:

ApproachMethodologyExpected Outcomes
Conditional atpF knockoutTemperature-sensitive or inducible deletionDetermination of essentiality
Complementation with mutantsExpression of variant atpF proteinsIdentification of critical regions
Heterologous complementationatpF genes from different speciesAssessment of functional conservation
Chimeric proteinsDomain swapping between speciesMapping of species-specific functions

Advanced Biophysical Techniques:

  • Cryo-electron microscopy of the intact ATP synthase complex with and without modification to atpF

  • Single-molecule FRET to monitor conformational changes during catalysis

  • High-resolution atomic force microscopy to visualize structural arrangements

Taking inspiration from studies of other bacterial systems, researchers could apply approaches similar to those used for Shigella T3SS ATPase (Spa47), where oligomerization and ATP hydrolysis were found to be essential for complete T3SS apparatus formation . For atpF, similar experiments could determine whether specific structural features are necessary for proper ATP synthase assembly and function, potentially revealing novel regulatory mechanisms or targets for antimicrobial development.

What are the major challenges in studying Shigella sonnei atpF?

Research on Shigella sonnei ATP synthase subunit b presents several significant challenges that researchers must address:

Technical Challenges:

  • Membrane protein expression and purification difficulties

  • Maintaining protein stability during biochemical and structural studies

  • Reconstituting functional ATP synthase complexes in vitro

  • Limited availability of Shigella-specific research tools compared to model organisms

Biological Challenges:

ChallengeImpactPotential Solutions
Laboratory handling of S. sonneiVirulence plasmid loss during cultivationOptimized growth conditions; plasmid stabilization approaches
Genetic manipulationLower transformation efficiencyAdapted protocols for Shigella; use of shuttle vectors
Functional redundancyCompensatory mechanismsCombined genetic approaches; conditional expression
Host-pathogen interactionsComplex environmental conditionsAdvanced infection models; in vivo imaging

One significant challenge in studying Shigella sonnei is the spontaneous loss of its virulence plasmid (pINV) during laboratory growth, leading to avirulence . This plasmid instability complicates research on virulence mechanisms and potential connections between metabolism and pathogenicity. Strategies to address this include optimizing growth conditions to maintain the plasmid and developing genetic systems that enhance plasmid stability through toxin-antitoxin systems or other mechanisms .

Future research may benefit from approaches that combine classical biochemistry with advanced systems biology, structural biology, and infection models to provide a more integrated understanding of ATP synthase function in the context of Shigella physiology and pathogenesis.

How might advances in structural biology enhance our understanding of atpF function?

Recent advances in structural biology techniques offer unprecedented opportunities to enhance our understanding of ATP synthase subunit b structure and function in Shigella sonnei:

Emerging Structural Approaches:

  • Cryo-electron microscopy for near-atomic resolution of membrane protein complexes

  • Solid-state NMR for studying membrane proteins in native-like environments

  • Integrative structural biology combining multiple data sources

  • Time-resolved structural methods to capture dynamic states

Potential Insights from Structural Studies:

Structural AspectPotential FindingsImplications
Membrane-embedded domainLipid interactions; oligomerization interfacesTarget sites for inhibitors
Cytoplasmic domainConformational flexibility; interaction sitesMechanism of energy transfer
Full ATP synthase complexSubunit arrangement; rotary mechanismComplete functional understanding
Species-specific featuresUnique structural elements in S. sonneiSelective targeting strategies

Similar structural approaches have proven valuable in studying other bacterial systems. For instance, high-resolution crystal structures of the Shigella T3SS ATPase Spa47 revealed key insights into its mechanism, including the identification of an "arginine finger" responsible for activation upon oligomerization . These structures guided biochemical studies that mapped critical residues involved in ATP hydrolysis and oligomer formation .

By applying similar approaches to atpF and the complete ATP synthase complex, researchers could potentially:

  • Identify critical interfaces for protein-protein interactions

  • Discover allosteric regulatory sites

  • Understand the structural basis for energy coupling during ATP synthesis

  • Develop structure-based approaches for antibiotic design targeting Shigella-specific features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.