Recombinant Shigella sonnei Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Outer Membrane Localization and Virulence

  • CL in the outer membrane facilitates the proper localization of virulence factors like IcsA, which promotes actin polymerization for bacterial motility and intercellular spread .

  • S. flexneri mutants lacking CL (clsA or pbgA) exhibit defective IcsA surface presentation and reduced plaque formation .

Species-Specific Adaptations

  • S. sonnei has acquired unique O-antigen modifications (e.g., -acetamido-2-deoxy-l-altruronic acid) that may alter membrane interactions with host cells .

  • Transcriptomic studies indicate S. sonnei upregulates acid resistance and biofilm formation genes during infection, potentially linked to CL-mediated membrane stability .

Research Applications and Experimental Data

Recombinant cls is utilized in:

Enzymatic Assays

  • Cardiolipin Synthesis: In vitro reconstitution of CL from PG substrates to study catalytic efficiency .

  • Membrane Model Systems: Incorporation into lipid bilayers to analyze CL’s role in membrane curvature and protein localization .

Pathogenicity Studies

  • Mutant Complementation: Plasmid-based expression of cls restores CL production in cls-deficient mutants, enabling functional rescue assays .

  • Antibody Detection: ELISA kits using recombinant cls as an antigen to detect host immune responses .

ApplicationMethodOutcome
Enzyme kineticsThin-layer chromatography (TLC)Quantification of CL synthesis rate
Membrane protein localizationFluorescence microscopyIcsA surface presentation analysis
Antibody detectionELISASerological studies of Shigella infections

Challenges and Future Directions

  • Limited Direct Data: Most functional studies focus on S. flexneri; S. sonnei-specific cls research is emerging .

  • Antibiotic Resistance: CL’s role in membrane stability may influence antibiotic susceptibility (e.g., fosfomycin resistance) .

  • Therapeutic Targeting: Inhibiting cls could disrupt CL synthesis, impairing bacterial replication and virulence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
clsA; cls; SSON_1931; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase and what are its primary functions in Shigella sonnei?

Cardiolipin synthase (Cls) is an essential enzyme responsible for synthesizing cardiolipin, a signature phospholipid of bacterial membranes. In Shigella sonnei, similar to S. flexneri, cardiolipin synthase catalyzes the formation of cardiolipin through the condensation of phospholipid molecules. In bacteria like E. coli and S. flexneri, cardiolipin synthesis occurs through multiple pathways: ClsA and ClsB condense two phosphatidylglycerol molecules, while ClsC condenses phosphatidylglycerol and phosphatidylethanolamine . This enzyme is crucial for maintaining membrane integrity, especially at bacterial poles, and plays a significant role in bacterial pathogenesis. The resulting cardiolipin comprises approximately 7% of total phospholipids during exponential growth in Shigella species .

How do the different cardiolipin synthase isoforms (ClsA, ClsB, ClsC) function in Shigella species?

In Shigella species, three cardiolipin synthase isoforms have been identified with distinct functions:

  • ClsA: Serves as the primary cardiolipin synthase during exponential growth phase. Deletion of clsA in S. flexneri results in undetectable cardiolipin levels and increased phosphatidylglycerol concentration .

  • ClsB: Plays a minor role during normal growth conditions. Single deletion of clsB shows minimal effect on cardiolipin levels (approximately 6% of total phospholipids) during exponential growth .

  • ClsC: Functions predominantly during stationary phase. While its contribution is minimal during exponential growth, ClsC becomes significantly active during stationary phase, accounting for approximately 1% of cardiolipin production in clsA mutants .

These isoforms differ in substrate preference and activity during different growth phases, providing metabolic flexibility to the bacterium.

What is the importance of cardiolipin in bacterial membranes and virulence?

Cardiolipin serves several critical functions in bacterial membranes:

  • Structural role: Contributes to membrane organization and stability, particularly at bacterial poles

  • Protein interaction: Binds with high affinity to numerous inner membrane proteins, including respiratory complexes

  • Supramolecular organization: Required for the formation and stabilization of respiratory chain supercomplexes, essential for proper electron transport chain function

  • Virulence contribution: Essential for pathogenesis, as demonstrated in S. flexneri where clsA mutants form only pinpoint plaques in cell monolayers compared to wild-type strains

  • Growth phase adaptation: Increases from approximately 7% to 10% of total phospholipids during transition from exponential to stationary phase

Importantly, not only synthesis but also proper localization of cardiolipin is critical for virulence, as evidenced by the complete inability of pbgA mutants (defective in cardiolipin transport to the outer membrane) to form plaques .

How does membrane topology affect cardiolipin synthase function in Shigella?

Membrane topology critically influences cardiolipin synthase function in Shigella species. Recent research has revealed that:

  • Domain orientation: ClsA contains transmembrane domains with a cytoplasmic catalytic domain, and this specific arrangement is essential for enzymatic activity

  • TMD specificity: Studies show that swapping the transmembrane domains (TMDs) of ClsA with those from other proteins (e.g., LepB) significantly diminishes or eliminates cardiolipin synthesis activity

  • Catalytic domain position: The catalytic C-terminal globular domain of ClsA depends on its native TMDs for proper function, as demonstrated by diminished activity when these domains are replaced

  • Adaptive flexibility: Under specific conditions such as phosphatidylethanolamine depletion, ClsA can undergo remarkable conformational changes, flipping its catalytic domain to supply cardiolipin to different membrane leaflets

This topological complexity highlights why recombinant expression of functional cardiolipin synthase must preserve the native membrane integration properties of the enzyme.

What experimental approaches can effectively measure cardiolipin synthase activity?

Measuring cardiolipin synthase activity requires specialized techniques addressing both the enzyme's membrane-associated nature and its lipid products:

  • Thin-layer chromatography (TLC): The standard method involves Bligh-Dyer phospholipid isolation followed by TLC separation. This technique effectively visualizes cardiolipin and can be quantified through densitometric analysis .

  • Genetic complementation assays: Expressing recombinant S. sonnei cls in deletion mutants (e.g., clsA, clsB, clsC single or multiple mutants) and measuring restoration of cardiolipin synthesis provides functional validation .

  • Growth-phase specific analysis: Comparing phospholipid profiles between exponential and stationary phases reveals distinct activities of different Cls enzymes, particularly the increased contribution of ClsC during stationary phase .

  • Radioactive or fluorescently-labeled substrates: Incorporating labeled phospholipid precursors allows tracking of cardiolipin synthesis with higher sensitivity.

  • Mass spectrometry: Provides detailed analysis of cardiolipin species, including acyl chain composition and modifications.

These complementary approaches allow comprehensive characterization of both wild-type and recombinant cardiolipin synthase activity.

How does cardiolipin synthase activity change during different growth phases in Shigella?

Research with S. flexneri provides insights into growth phase-dependent changes in cardiolipin synthase activity that likely apply to S. sonnei:

  • Exponential phase:

    • ClsA serves as the predominant cardiolipin synthase

    • Cardiolipin constitutes approximately 7% of total phospholipids

    • ClsB and ClsC contribute minimally during this phase

  • Stationary phase:

    • Total cardiolipin levels increase to approximately 10% of phospholipids

    • ClsA remains important but is no longer the sole contributor

    • ClsC becomes significantly active, producing detectable cardiolipin (~1%) even in clsA mutants

    • Double mutants (clsA clsC) completely lack cardiolipin during stationary phase

  • Intracellular environment:

    • Expression analysis shows both clsB and clsC are induced approximately 10-fold in intracellular bacteria

    • Despite this induction, they cannot fully compensate for clsA deletion, as clsA mutants still form only pinpoint plaques

This growth phase-dependent regulation allows bacteria to adapt membrane composition to changing environmental conditions.

What is the role of cardiolipin in Shigella pathogenesis and host-pathogen interactions?

Cardiolipin plays crucial roles in Shigella pathogenesis through multiple mechanisms:

  • Plaque formation: In S. flexneri, clsA mutants form only pinpoint plaques compared to wild-type strains, indicating severe impairment in the infection cycle .

  • Outer membrane localization: Transport of cardiolipin to the outer membrane by PbgA is absolutely essential for virulence, as pbgA mutants completely lose the ability to form plaques .

  • Intracellular survival: Though clsB and clsC are induced approximately 10-fold in intracellular bacteria, they cannot compensate for clsA deletion, suggesting unique functions for ClsA-synthesized cardiolipin during infection .

  • Membrane architecture: Cardiolipin contributes to bacterial membrane organization, potentially affecting interactions with host cell components and resistance to host defense mechanisms.

  • Respiratory function: By stabilizing respiratory complexes, cardiolipin supports energy metabolism during infection, which is critical for bacterial proliferation in the host environment .

These findings highlight cardiolipin synthase as a potential target for antimicrobial development to attenuate Shigella virulence.

What expression systems are optimal for producing functional recombinant S. sonnei cardiolipin synthase?

Producing functional recombinant S. sonnei cardiolipin synthase requires careful consideration of its membrane-associated nature:

  • Host selection:

    • E. coli C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Alternative hosts like Lactococcus lactis for proteins toxic to E. coli

  • Vector design:

    • Inducible promoters with tight regulation (T7, araBAD)

    • Fusion tags that enhance solubility (MBP, SUMO) while allowing purification (His6, Strep)

    • Inclusion of native transmembrane domains, as research shows these are critical for enzymatic activity

  • Expression conditions:

    • Lower temperatures (16-20°C) to improve proper membrane integration

    • Reduced inducer concentrations (0.1-0.5 mM IPTG)

    • Extended expression times (overnight) at lower temperatures

  • Membrane extraction:

    • Gentle detergent screening (DDM, LDAO, digitonin) for optimal solubilization

    • Lipid supplementation during purification to maintain enzyme stability

Research with related cardiolipin synthases indicates that preservation of native transmembrane domains is particularly critical, as chimeric constructs with substituted transmembrane regions show diminished or abolished activity .

What genetic approaches can be used to study cardiolipin synthase function in Shigella?

Several genetic strategies can effectively investigate cardiolipin synthase function in Shigella:

  • Gene deletion mutants:

    • Single deletions of clsA, clsB, and clsC

    • Double and triple mutant combinations to assess functional redundancy

    • Clean deletions using scarless techniques to avoid polar effects

  • Complementation studies:

    • Plasmid-based expression of wild-type cls genes in corresponding mutants

    • Cross-complementation between Shigella species or E. coli to assess functional conservation

    • Domain swapping to identify critical regions for enzyme function

  • Promoter reporter fusions:

    • Transcriptional fusions to monitor cls gene expression under various conditions

    • Analysis of growth phase-dependent regulation

    • Identification of environmental signals affecting expression

  • Protein tagging:

    • Fluorescent protein fusions to visualize enzyme localization

    • Epitope tagging for immunoprecipitation studies

    • Conditional degradation systems for temporal control of protein levels

These approaches have revealed that while clsA is the predominant cardiolipin synthase during exponential growth, clsC contributes significantly during stationary phase, and both clsB and clsC are induced in the intracellular environment .

How can researchers analyze phospholipid composition in S. sonnei cls mutants?

Comprehensive analysis of phospholipid composition in S. sonnei cls mutants requires a multi-technique approach:

  • Lipid extraction and TLC:

    • Bligh-Dyer extraction followed by thin-layer chromatography provides a robust method for separating and visualizing major phospholipid species

    • This approach effectively distinguished the absence of cardiolipin in clsA mutants during exponential growth and revealed residual cardiolipin production by ClsC during stationary phase

  • Quantitative analysis:

    • Densitometric scanning of TLC plates allows determination of relative phospholipid percentages

    • In wild-type S. flexneri, cardiolipin constitutes approximately 7% of total phospholipids during exponential growth and increases to 10% in stationary phase

  • Growth condition variations:

    • Analysis across growth phases (exponential vs. stationary)

    • Comparison between in vitro and intracellular growth

    • Response to environmental stresses

  • Advanced analytical techniques:

    • Mass spectrometry for detailed cardiolipin species identification

    • 31P-NMR spectroscopy for phospholipid head group analysis

    • Fluorescence microscopy with cardiolipin-specific probes for localization studies

This analytical workflow has proven effective in characterizing the distinct contributions of ClsA and ClsC during different growth phases in S. flexneri and can be applied to S. sonnei research .

What purification strategies yield high-quality recombinant S. sonnei cardiolipin synthase?

Purifying active recombinant S. sonnei cardiolipin synthase requires strategies that maintain its native membrane-associated structure:

  • Membrane preparation:

    • Gentle cell lysis preserving membrane integrity

    • Differential centrifugation to isolate membrane fractions

    • Optimization of buffer conditions (pH, salt concentration, glycerol)

  • Solubilization screening:

    • Systematic testing of detergents (DDM, LDAO, digitonin)

    • Evaluation of solubilization efficiency while preserving activity

    • Consideration of lipid-detergent mixed micelles

  • Affinity chromatography:

    • Utilization of fusion tags (His6, Strep) for initial capture

    • Optimization of binding and elution conditions

    • On-column detergent exchange if needed

  • Size exclusion chromatography:

    • Assessment of protein homogeneity and oligomeric state

    • Detection of protein-lipid complexes

    • Buffer optimization for stability

  • Activity preservation:

    • Addition of stabilizing lipids during purification

    • Inclusion of glycerol or other osmolytes

    • Storage conditions preventing aggregation or denaturation

Research with membrane proteins shows that retention of native transmembrane domains is critical, as studies with ClsA indicate that these domains are essential for catalytic activity of the C-terminal globular domain .

What structural features are critical for S. sonnei cardiolipin synthase function?

Based on studies with related cardiolipin synthases, several structural features are likely critical for S. sonnei Cls function:

  • Transmembrane domains: Research demonstrates that the native transmembrane domains of ClsA are essential for catalytic activity. Replacement of these domains with those from other proteins (e.g., LepB) significantly reduces or eliminates enzymatic function .

  • Catalytic domain orientation: The positioning of the C-terminal globular domain relative to the membrane appears crucial. Studies show that extending the region following transmembrane domains diminishes cardiolipin synthesis activity .

  • Conserved motifs: Sequence comparisons of cardiolipin synthases from various organisms, including yeasts, plants, and bacteria, reveal at least five conserved motifs that likely form the active site or are involved in substrate binding .

  • Domain flexibility: Recent research indicates that under specific conditions, such as phosphatidylethanolamine depletion, ClsA can undergo conformational changes that reposition its catalytic domain, suggesting a dynamic structure responsive to membrane composition .

  • Substrate recognition sites: Distinct binding pockets for phosphatidylglycerol and/or phosphatidylethanolamine are required for the different Cls isoforms, reflecting their substrate preferences.

These structural insights are valuable for understanding enzyme mechanism and designing potential inhibitors.

How can researchers develop inhibitors targeting S. sonnei cardiolipin synthase?

Developing inhibitors targeting S. sonnei cardiolipin synthase requires a multifaceted approach:

  • Target site identification:

    • Homology modeling based on related enzymes

    • Identification of conserved catalytic residues

    • Molecular dynamics simulations to reveal binding pockets

  • Rational design strategies:

    • Substrate analogs that compete with phosphatidylglycerol

    • Transition state mimics for the condensation reaction

    • Allosteric inhibitors targeting regulatory sites

  • Screening approaches:

    • In silico screening against modeled enzyme structure

    • Biochemical assays using purified enzyme

    • Whole-cell assays measuring cardiolipin synthesis inhibition

  • Lead optimization:

    • Structure-activity relationship studies

    • Enhancement of membrane permeability

    • Reduction of toxicity against host cells

  • Efficacy evaluation:

    • Plaque formation assays (as clsA mutants show reduced plaque size)

    • Bacterial membrane integrity assessment

    • Testing in infection models

Given that cardiolipin synthase is critical for S. flexneri virulence, with clsA mutants forming only pinpoint plaques , inhibiting this enzyme represents a promising strategy for developing novel antimicrobials against Shigella infections.

How does recombinant S. sonnei cardiolipin synthase compare with the native enzyme?

Comparing recombinant and native S. sonnei cardiolipin synthase requires consideration of several factors:

  • Expression context effects:

    • Membrane composition differences between expression hosts and native environment

    • Potential alterations in enzyme folding and topology

    • Effects of fusion tags on activity and membrane integration

  • Functional assessment methods:

    • Complementation of cls mutants provides a reliable measure of functional equivalence

    • Direct enzyme activity comparisons using identical substrates and conditions

    • Membrane integration analysis using protease accessibility assays

  • Structural considerations:

    • Preservation of critical transmembrane domains, as research shows these are essential for activity

    • Native-like orientation of the catalytic domain relative to the membrane

    • Maintenance of oligomeric state if applicable

  • Activity optimization:

    • Lipid environment reconstitution to mimic native membranes

    • Buffer composition adjustments to reflect physiological conditions

    • Consideration of growth phase-specific activity differences

Research with other membrane proteins suggests that recombinant expression can yield enzymes with native-like activity if expression conditions and purification strategies are carefully optimized to maintain proper membrane integration and topology.

How do cardiolipin synthases differ between Shigella species and related bacteria?

Cardiolipin synthases show notable similarities and differences across Shigella species and related bacteria:

These comparative insights help identify conserved features essential for function versus species-specific adaptations.

What can we learn from cardiolipin synthase studies in other organisms?

Research on cardiolipin synthases across diverse organisms provides valuable insights:

  • Enzymatic mechanisms:

    • Eukaryotic cardiolipin synthesis from phosphatidyl-CMP and phosphatidylglycerol was first demonstrated in rat liver mitochondria

    • Similar mechanisms exist in yeast, plants, fungi, and animals, suggesting evolutionary conservation

  • Genetic characterization:

    • Cardiolipin synthase genes have been identified and characterized in yeast, Arabidopsis, and humans

    • These enzymes share homologous domains with masses of 32.0, 38.0, and 32.6 kDa for yeast, Arabidopsis, and human cardiolipin synthase, respectively

  • Function in organelles:

    • In eukaryotes, cardiolipin is the signature phospholipid of the mitochondrial inner membrane

    • In Arabidopsis, cardiolipin synthase is crucial for correct mitochondrial function and development under both optimal and stress conditions

  • Medical relevance:

    • Disturbances in cardiolipin metabolism are central to human Barth syndrome

    • Cardiolipin abnormalities may play roles in diabetes and ischemic heart disease

These comparative studies provide evolutionary context and highlight the fundamental importance of cardiolipin across domains of life.

How is cardiolipin synthase activity integrated with other phospholipid biosynthesis pathways?

Cardiolipin synthase functions within an interconnected network of phospholipid metabolism:

  • Biosynthetic precursors:

    • Cardiolipin synthesis begins with phosphatidic acid formation from glycerol-3-phosphate and activated fatty acids

    • Phosphatidylglycerol, the immediate precursor for cardiolipin, is formed through phosphatidylglycerophosphate intermediate

  • Pathway regulation:

    • Growth phase-dependent regulation is evident, with increased cardiolipin synthesis during stationary phase

    • Environmental conditions influence expression of different cls genes

    • Intracellular growth induces expression of clsB and clsC approximately 10-fold

  • Membrane composition balance:

    • Deletion of clsA results in increased phosphatidylglycerol levels, demonstrating metabolic compensation

    • Proper ratios of different phospholipids are maintained for membrane function

  • Acyl chain remodeling:

    • After initial synthesis, cardiolipin undergoes acyl chain modifications

    • This remodeling produces cardiolipin species with specific fatty acid compositions

    • Eukaryotic mitochondria produce cardiolipin with high structural uniformity, often with four identical acyl chains

Understanding these integrated pathways is essential for comprehending the broader impacts of targeting cardiolipin synthase.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.