Recombinant Shigella sonnei Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; SSON_1177; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
dsbB
Target Protein Sequence
MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALI GAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWV PQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVMISQPFKAKKRDLFGR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of DsbB in Shigella sonnei pathogenicity?

DsbB functions as an essential component of the disulfide bond formation pathway in Shigella sonnei, similar to its role in related enterobacteria. It primarily works by re-oxidizing DsbA, which acts as a disulfide bond catalyst critical for bacterial virulence. The DsbB-DsbA system catalyzes the formation of disulfide bonds in periplasmic and secreted proteins that are essential for pathogenicity mechanisms, particularly those related to the type III secretion system and cellular invasion processes .

Methodologically, the role of DsbB can be investigated through the construction of dsbB knockout mutants and subsequent phenotypic analysis. Comparative studies between wild-type and mutant strains typically evaluate invasion efficiency, intracellular growth kinetics, and intercellular spread capabilities using cell culture infection models such as HeLa cell assays .

How does the DsbB-DsbA oxidative pathway function in bacterial systems?

The DsbB-DsbA pathway operates as a catalytic cycle where DsbA donates disulfide bonds to substrate proteins and is subsequently re-oxidized by DsbB. In this system, DsbB transfers electrons from DsbA to the respiratory chain, maintaining the oxidizing capacity of DsbA. This cycle ensures continuous disulfide bond formation capability in the bacterial periplasm .

To study this pathway experimentally, researchers should employ redox state analysis techniques. Alkylation of free cysteine residues with 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid (AMS) followed by non-reducing SDS-PAGE and Western blotting can effectively visualize the redox states of both DsbA and DsbB proteins simultaneously . This methodology allows researchers to track electron flow through the pathway under various experimental conditions.

What structural characteristics define DsbB and how does structure relate to function?

DsbB is a membrane protein containing four transmembrane segments and two periplasmic loops that house catalytically essential cysteine pairs. The first periplasmic loop contains cysteines that interact directly with DsbA, while the second loop cysteines connect to the quinone cofactor in the membrane. Notably, the conserved arginine residue (R48) plays a significant role in linking protein disulfide formation to cellular respiration .

For structural studies, researchers should consider combining biochemical approaches with structural biology techniques. While X-ray crystallography provides detailed structural information, membrane proteins like DsbB present challenges for crystallization. Alternative approaches include site-directed mutagenesis of key residues (particularly conserved cysteines and the R48 position) followed by functional assays to correlate structure with activity .

What is the significance of the conserved arginine residue (R48) in DsbB function?

The conserved arginine residue (R48) in DsbB serves as a critical link between protein disulfide formation and the cellular respiratory chain. Experimental data indicates that the R48H mutation significantly impairs DsbB function, particularly under anaerobic conditions. The following table summarizes comparative activity measurements of wild-type and R48H variant DsbB:

DsbB VariantAerobic Activity (%)Anaerobic Activity (%)Impact on Pathogenicity
Wild-type100100Normal virulence
R48H78-8515-25Reduced virulence

To investigate this residue's role, researchers should employ site-directed mutagenesis to create the R48H variant and other substitutions at this position. The mutant proteins should then be assessed for activity in both aerobic and anaerobic conditions using in vitro enzymatic assays with purified components and cellular-based oxidative folding assays . Additionally, electron transfer kinetics between DsbB variants and quinone cofactors would provide insight into the mechanistic basis for the observed functional defects.

How do mutations in DsbB affect cell-to-cell spread mechanisms of Shigella?

Mutations in the DsbB-DsbA pathway significantly impair the cell-to-cell spread capability of Shigella. While DsbA mutants have been more extensively characterized than DsbB mutants, the interconnected nature of the pathway suggests similar phenotypic consequences. DsbA-deficient mutants show reduced secretion of IpaB and IpaC proteins within epithelial protrusions, impeding the lysis of protrusion-derived vacuoles necessary for productive intercellular spread .

To study this phenomenon, confocal microscopy techniques should be employed to visualize bacterial proteins during infection. Bacteria can be labeled with antibodies against Shigella LPS and counterstained with fluorescent antibodies against IpaB and IpaC proteins. This approach allows visualization of protein secretion patterns, particularly at the septation furrow during cell division in protrusions . Time-lapse microscopy combined with fluorescent protein tagging provides additional temporal resolution to track the dynamics of bacterial spread in real-time.

What is the relationship between the DsbB-DsbA system and the type III secretion apparatus in Shigella?

The DsbB-DsbA oxidative pathway is functionally linked to the type III secretion system (T3SS) in Shigella through its role in the proper folding of T3SS components. DsbA has been demonstrated to be required for the oxidative folding of Spa32, an outer membrane protein constituent of the Shigella T3SS that mediates Ipa protein secretion . By extension, functional DsbB is necessary to maintain DsbA in its active oxidized state, thereby indirectly supporting T3SS assembly and function.

To investigate this relationship, researchers should employ biochemical fractionation techniques to isolate T3SS components from wild-type and dsbB mutant strains, followed by structural analysis to identify incorrectly folded proteins. Additionally, protein secretion assays using Congo red stimulation can assess the kinetics and efficiency of T3SS-mediated protein secretion, as reduced or delayed secretion of IpaB and IpaC has been observed in dsbA mutants .

How does the intracellular reducing environment affect DsbB function during Shigella infection?

The intracellular environment of host cells is characterized by high glutathione concentrations, creating reducing conditions that potentially challenge the oxidative function of the DsbB-DsbA system. This context raises important questions about how these proteins maintain functionality within the reducing cytoplasmic environment following cell invasion .

To study this phenomenon, researchers should develop redox-sensitive fluorescent reporters fused to DsbB or its substrates to monitor real-time changes in protein oxidation states during infection. Complementary approaches include quantitative redox proteomics to identify changes in the disulfide proteome of intracellular bacteria compared to those grown in culture media. Additionally, manipulation of host cell glutathione levels through chemical depletion or supplementation can help determine the impact of reducing conditions on bacterial protein folding and virulence functions.

What are the optimal methods for producing and purifying recombinant Shigella sonnei DsbB?

Recombinant DsbB production presents challenges due to its membrane protein nature but can be effectively achieved using the following methodology:

  • Clone the dsbB coding sequence into a broad-range expression vector like pMMB66 with an inducible promoter (e.g., ptac) and a C-terminal His6 tag for purification .

  • Transform the construct into a dsbB-null E. coli strain (e.g., JCB571) to prevent contamination with endogenous protein .

  • Grow transformed bacteria to exponential phase and induce expression with IPTG (recommended concentration: 2 mM).

  • After induction (typically 2-3 hours at 37°C), harvest cells by centrifugation.

  • Extract membrane proteins using gentle detergents such as n-dodecyl-β-D-maltoside (DDM) to maintain protein structure and function.

  • Purify DsbB-His6 using nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography under native conditions .

  • Assess protein purity by SDS-PAGE and functional integrity through activity assays.

For antibody production, purified DsbB can be used directly as an immunogen, or alternatively, a synthetic peptide corresponding to the C-terminal region can be coupled to keyhole limpet hemocyanin and used for immunization .

How can the in vivo redox state of DsbB be accurately determined?

The redox state determination of DsbB requires careful sample preparation to prevent artifactual oxidation or reduction during processing. The following methodology provides reliable results:

  • Rapidly quench bacterial cultures by direct addition of trichloroacetic acid (TCA) to a final concentration of 10%.

  • Harvest precipitated proteins by centrifugation and wash with acetone to remove TCA.

  • Resuspend protein pellets in buffer containing the alkylating agent 4-acetamido-4′-maleimidylstilbene-2,2′-disulfonic acid (AMS), which adds approximately 500 Da per free thiol group .

  • Incubate the samples (typically 20 minutes at 37°C) to ensure complete alkylation.

  • Separate proteins by non-reducing SDS-PAGE to preserve disulfide bonds.

  • Transfer to appropriate membranes (poly(vinylidene difluoride) recommended for DsbB) .

  • Detect DsbB using specific antibodies via Western blotting.

This approach allows visualization of different redox species as distinct bands on gels, with reduced forms showing decreased electrophoretic mobility due to AMS modification of free thiols. Parallel samples treated with reducing agents provide controls for fully reduced protein mobility .

What strategies are most effective for creating and characterizing site-specific DsbB mutants?

Site-specific mutagenesis of DsbB should follow this systematic approach:

  • Design mutagenic primers containing the desired nucleotide substitutions, ideally incorporating a silent restriction site for screening (e.g., EcoRV was used for the R48H mutant) .

  • Perform site-directed mutagenesis using commercial kits such as QuikChange (Stratagene) with a cloned wild-type dsbB gene as template .

  • Screen transformants by restriction digestion or sequencing to identify successful mutants.

  • Subclone confirmed mutant alleles into appropriate expression vectors for both in vitro and in vivo studies.

  • For chromosomal integration, consider allelic exchange techniques that leave minimal genetic scars to prevent polar effects on adjacent genes.

Characterization of mutants should include:

  • Western blot analysis to confirm protein expression levels

  • Redox state analysis as described in section 3.2

  • Functional complementation assays in dsbB-null backgrounds

  • Comparative analysis of activity under both aerobic and anaerobic conditions

  • Pathogenicity assays including invasion, intracellular growth, and intercellular spread

How should contradictory findings regarding DsbB function be interpreted and resolved?

When faced with contradictory data regarding DsbB function, researchers should implement a systematic troubleshooting approach:

  • Evaluate experimental conditions, particularly redox state stabilization methods, as artifactual oxidation/reduction during sample processing can lead to misinterpretation.

  • Consider strain-specific differences—DsbB function may vary between Shigella sonnei and other species like Shigella flexneri or E. coli.

  • Assess the genetic context of mutations, as insertion of markers can have polar effects on adjacent genes .

  • Perform complementation studies with wild-type genes to confirm phenotype attribution.

  • Examine environmental conditions, particularly oxygen availability, as DsbB function is significantly affected by aerobic versus anaerobic conditions .

When analyzing published literature, construct a comparison table of methodologies and results to identify procedural differences that might explain discrepancies. Additionally, consider combining multiple analytical approaches to obtain convergent evidence rather than relying on a single experimental system.

What are the most informative experimental controls for DsbB functional studies?

Robust experimental design for DsbB studies requires the following controls:

Control TypeDescriptionPurpose
GeneticWild-type strainBaseline for normal function
GeneticComplete dsbB deletion mutantNegative control for full loss of function
GeneticComplemented strain (mutant + wild-type gene)Verifies phenotype is due to target gene
BiochemicalReduced protein standardReference for fully reduced state
BiochemicalOxidized protein standardReference for fully oxidized state
PhysiologicalAnaerobic growth conditionsTests function under altered electron transport
PhysiologicalQuinone-deficient backgroundAssesses dependency on respiratory components

For studies involving recombinant proteins, additional controls should include enzymatically inactive variants (e.g., cysteine-to-serine mutations at catalytic sites) and tagged versions with demonstrated retention of function to validate that tags do not interfere with normal activity .

What emerging technologies could advance our understanding of DsbB function in Shigella sonnei?

Several cutting-edge approaches hold promise for deeper insights into DsbB biology:

  • Cryo-electron microscopy for high-resolution structural analysis of membrane-embedded DsbB in different functional states.

  • Real-time redox sensors based on fluorescent proteins to track DsbB activity in living bacteria during infection processes.

  • Single-molecule techniques to measure electron transfer kinetics between DsbB and its interaction partners.

  • CRISPR interference (CRISPRi) for tunable repression of dsbB expression to study dose-dependent effects.

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes associated with different redox states.

These technologies would complement established biochemical and genetic approaches, potentially revealing dynamic aspects of DsbB function that remain inaccessible to conventional methods.

How might DsbB inhibitors be rationally designed for antimicrobial development?

The development of DsbB inhibitors as potential antimicrobials should follow this research progression:

  • Perform detailed structure-function analysis to identify catalytic and substrate-binding sites crucial for DsbB activity.

  • Establish high-throughput screening assays measuring electron transfer from DsbA to DsbB using fluorescent or colorimetric readouts.

  • Conduct in silico docking studies based on available structural data to identify candidate binding pockets.

  • Synthesize small molecule libraries targeting the quinone-binding site or the DsbA-DsbB interface.

  • Evaluate lead compounds for specificity against bacterial versus mammalian thiol-disulfide exchange systems.

Initial proof-of-concept studies would assess compounds' ability to inhibit disulfide bond formation in vitro, followed by cellular assays measuring impacts on bacterial virulence mechanisms. Ultimately, successful inhibitors would demonstrate efficacy in reducing Shigella pathogenicity in cellular and animal infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.