Recombinant Shigella sonnei Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction to RnfE Protein

The Electron transport complex protein RnfE is an integral component of Shigella sonnei's energy production system. As part of the bacterial electron transport chain, this protein plays a crucial role in the oxidation-reduction processes that generate energy for cellular activities. RnfE belongs to the Rnf (Rhodobacter nitrogen fixation) complex, which functions as an ion-translocating oxidoreductase complex involved in energy conservation mechanisms in various bacteria .

Shigella sonnei, the bacterial source of this protein, has emerged as a significant global pathogen. It is currently the most common agent of shigellosis in high-income countries and poses a substantial disease burden in low and middle-income nations . Understanding the functional components of this pathogen, including its electron transport systems, provides valuable insights into bacterial physiology and potential intervention strategies.

The recombinant form of RnfE protein is produced through genetic engineering techniques, enabling researchers to study its properties and functions in isolation from the bacterial host. This recombinant version typically includes specific modifications such as histidine tags to facilitate purification and experimental applications .

Gene Information

The gene encoding the RnfE protein in Shigella sonnei is designated as rnfE, with alternative nomenclature including rsxE according to genomic databases. The ordered locus name for this gene is SSON_1526 . This gene is part of the rnf operon, which encodes multiple components of the electron transport complex.

Functional Domains and Predicted Activity

Based on sequence analysis and comparison with homologous proteins, the RnfE protein likely contains several functional domains associated with electron transport. The transmembrane regions facilitate embedding within the bacterial cell membrane, while other portions may participate in redox reactions or protein-protein interactions within the electron transport complex.

The protein is classified as an "Ion-translocating oxidoreductase complex subunit E" or "Rsx electron transport complex subunit E," indicating its role in energy conservation through ion translocation coupled with electron transfer processes . These functions are essential for the bacterium's energy metabolism under various environmental conditions.

Expression Systems and Methods

The recombinant RnfE protein is typically produced in Escherichia coli expression systems, which provide an efficient platform for generating bacterial proteins. The production process involves cloning the rnfE gene from Shigella sonnei into appropriate expression vectors, transforming these vectors into E. coli host cells, and inducing protein expression under controlled conditions .

For research and commercial applications, the full-length protein (amino acids 1-231) is expressed with an N-terminal histidine tag, which facilitates subsequent purification steps. The His-tag consists of multiple histidine residues that have high affinity for metal ions, enabling purification through metal affinity chromatography .

Reconstitution Protocol

For optimal reconstitution of lyophilized RnfE protein, the following protocol is recommended:

  1. Centrifuge the vial briefly to bring contents to the bottom before opening

  2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (with 50% being the manufacturer's default recommendation)

  4. Aliquot the solution for long-term storage at -20°C or -80°C

This reconstitution method helps maintain protein stability and functionality for research applications .

Role in Bacterial Physiology

The RnfE protein, as part of the larger Rnf complex, plays a significant role in the bacterial electron transport chain. This complex couples the transfer of electrons with the translocation of ions across the cell membrane, contributing to the generation of a proton motive force that drives ATP synthesis .

In Shigella sonnei, this energy generation system is particularly important for survival under various environmental conditions, including the stressful environment encountered during host infection. Understanding these energy mechanisms provides insights into bacterial adaptation and pathogenesis.

Relevance to Shigella sonnei Pathogenesis

Shigella sonnei has emerged as a globally significant pathogen that causes shigellosis, characterized by bloody diarrhea. The bacterium has surpassed Shigella flexneri as the leading cause of shigellosis in many regions of the world .

While the direct role of RnfE in pathogenesis is not fully characterized in the available literature, energy metabolism proteins like RnfE are fundamental to bacterial survival and replication during infection. Recent research has highlighted species-specific differences in transcriptomic responses between Shigella sonnei and Shigella flexneri during infection, including differences in energy generation and conservation mechanisms .

Potential Research Applications

The recombinant RnfE protein has several potential applications in research:

  1. Structural studies to elucidate the three-dimensional organization of bacterial electron transport complexes

  2. Functional assays to characterize the protein's role in electron transport and energy generation

  3. Development of antibodies against RnfE for immunological detection and localization studies

  4. Investigation of protein-protein interactions within the electron transport complex

  5. Potential target identification for novel antimicrobial strategies

These applications contribute to the broader understanding of bacterial physiology and may inform the development of interventions against Shigella infections .

Relationship to Other Electron Transport Proteins

The RnfE protein is part of a larger family of electron transport proteins found across various bacterial species. While specific comparative data for Shigella sonnei RnfE is limited in the provided search results, electron transport complexes are generally conserved across related bacterial species with adaptations specific to the organism's ecological niche and metabolic requirements.

In the context of Shigella species, recent research has highlighted differences in energy generation and conservation mechanisms between Shigella sonnei and other species like Shigella flexneri. For example, during infection of Caenorhabditis elegans, S. sonnei was found to upregulate energy generation and conservation genes compared to S. flexneri, which may contribute to its increasing global prevalence .

Evolution and Conservation

The gene encoding RnfE (also known as rsxE) appears to be conserved within Shigella species, suggesting its fundamental importance to bacterial metabolism. The RnfE protein is part of the conserved mechanisms that enable bacterial adaptation to diverse environments, including those encountered during host infection.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary based on purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
rsxE; SSON_1526; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRTEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
This protein is a component of a membrane-bound complex that facilitates the coupling of electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of RnfE protein in Shigella sonnei?

RnfE (also designated as rsxE) functions as a subunit of the ion-translocating oxidoreductase complex in Shigella sonnei. This protein is part of the electron transport chain that generates the proton motive force necessary for energy production in the bacterial cell. The Rnf complex specifically participates in electron transfer processes that are crucial for maintaining bacterial metabolism under various environmental conditions. Within Shigella sonnei's pathogenicity mechanisms, the electron transport system contributes to its survival during host invasion and environmental stress .

How does RnfE contribute to Shigella sonnei pathogenicity?

While RnfE itself isn't directly characterized as a virulence factor, it plays a supportive role in S. sonnei pathogenicity by contributing to cellular energy metabolism. S. sonnei has emerged as a globally important pathogen due to several mechanisms:

  • As part of the electron transport system, RnfE contributes to energy production necessary for bacterial growth and survival during infection.

  • S. sonnei possesses a Type VI Secretion System (T6SS) that allows it to outcompete other Enterobacteriaceae species like S. flexneri and E. coli in the gut microbiome, which could indirectly depend on efficient energy metabolism facilitated by complexes containing RnfE .

  • S. sonnei's unique O-antigen structure (containing -acetamido-2-deoxy-l-altruronic acid and 2-acetamido-2-deoxy-l-fucose) helps it resist phagolysosomal acidification and enhance neutrophil cell death, contributing to virulence that exceeds that of S. flexneri .

  • The multiple O-antigen layers on S. sonnei's surface contribute to its extra-cellular lifestyle and survival, which requires consistent energy production via electron transport complexes .

What role does RnfE play in Shigella sonnei's antibiotic resistance mechanisms?

  • S. sonnei has shown remarkable adaptability in acquiring antimicrobial resistance genes through mobile genetic elements (MGEs), including plasmids, transposons, and genomic islands .

  • The synergistic effect of antimicrobial resistance genes alongside integrons (especially class II integrons) increases the emergence and survival rate of resistant strains .

  • Fluoroquinolone resistance in globally distributed S. sonnei strains has been attributed to sequential mutations (gyrA-S83L, parC-S80I, and gyrA-D87G) that originated in South Asia around 2007 .

  • The energy-dependent efflux pumps, which may utilize the electron motive force generated by complexes containing RnfE, can contribute to antibiotic resistance by actively removing antimicrobial compounds from the bacterial cell.

Research methodologies to investigate the relationship between RnfE and antibiotic resistance could include:

  • Generation of RnfE knockout mutants to assess changes in antibiotic susceptibility

  • Transcriptomic analysis comparing expression of RnfE and related genes under antibiotic pressure

  • Metabolomic profiling to understand energy production alterations in antibiotic-resistant strains

How can recombinant RnfE protein be optimally expressed and purified for structural studies?

Based on the available data for recombinant Shigella sonnei RnfE protein, the following methodology is recommended for optimal expression and purification:

StepMethodologyParameters
Expression SystemE. coliOptimized for membrane protein expression
Vector DesignN-terminal His-tag fusionFacilitates purification via affinity chromatography
Culture ConditionsLB or TB mediaTypically at 37°C until OD600 ~0.6-0.8
InductionIPTG0.5-1.0 mM concentration
TemperaturePost-induction temperature reduction16-25°C for 12-18 hours
Cell LysisSonication or pressure-based methodsIn buffer containing detergents for membrane protein extraction
PurificationNi-NTA affinity chromatographyImidazole gradient elution
Secondary PurificationSize exclusion chromatographyTo achieve higher purity
StorageTris/PBS-based buffer with 6% Trehalose, pH 8.0Aliquot and store at -20°C/-80°C

For structural studies, additional considerations include:

  • Detergent screening to identify optimal conditions for maintaining protein stability while solubilizing membrane components

  • Addition of 5-50% glycerol to the final preparation to prevent freeze-thaw damage

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL before experimental use

  • Avoiding repeated freeze-thaw cycles which can significantly reduce protein activity and structural integrity

What experimental approaches can be used to investigate RnfE interactions with other components of the electron transport complex?

Understanding protein-protein interactions within the Rnf complex requires sophisticated methodological approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against RnfE (or its His-tag) to pull down the protein along with its interacting partners from bacterial lysates.

  • Bacterial Two-Hybrid (B2H) Assay: Cloning RnfE and potential interaction partners into reporter vectors to detect interactions based on reporter gene activation.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry analysis to identify proteins in close proximity to RnfE within the membrane environment.

  • FRET (Förster Resonance Energy Transfer): Tagging RnfE and potential partners with fluorescent proteins to detect energy transfer indicating close molecular proximity.

  • Surface Plasmon Resonance (SPR): Immobilizing purified RnfE on a sensor chip and measuring binding kinetics with other purified components of the electron transport complex.

Data analysis considerations should include:

  • Statistical validation of interaction specificity through appropriate controls

  • Quantitative assessment of binding affinities

  • Structural modeling of interaction interfaces

  • Functional validation through mutagenesis studies

How can researchers investigate the role of RnfE in proton translocation and energy generation?

To investigate RnfE's role in proton translocation and energy generation, researchers can employ several advanced biophysical and biochemical techniques:

  • Membrane Vesicle Preparations: Isolate inside-out membrane vesicles from Shigella sonnei expressing RnfE or from recombinant systems to directly measure proton pumping activity.

  • pH-sensitive Fluorescent Probes: Utilize fluorescent dyes like BCECF or pHrodo to monitor pH changes across membranes in response to electron transport activity.

  • Patch-Clamp Electrophysiology: Apply patch-clamp techniques to proteoliposomes containing reconstituted RnfE to measure ion currents directly.

  • Site-Directed Mutagenesis: Create point mutations in conserved residues of RnfE predicted to be involved in proton translocation, followed by functional assays to assess the impact on electron transport and energy generation.

  • Reconstitution Studies: Purify RnfE and other components of the electron transport complex and reconstitute them in liposomes to study their combined activity in a controlled environment.

TechniqueMeasurementAdvantageLimitation
Membrane VesiclesProton gradient formationNative-like environmentComplex preparation
Fluorescent ProbesReal-time pH changesHigh sensitivityPotential interference
Patch-ClampDirect ion current measurementSingle-molecule resolutionTechnically challenging
MutagenesisStructure-function relationshipPrecise mechanistic insightsLabor-intensive
ReconstitutionIsolated system analysisControlled conditionsMay not reflect in vivo complexity

What are the key considerations when using recombinant RnfE protein for antibody production and immunological studies?

When using recombinant Shigella sonnei RnfE protein for antibody production and immunological studies, researchers should consider:

  • Protein Purity: Ensure high purity (>90% as determined by SDS-PAGE) to prevent antibodies against contaminants .

  • Protein Conformation: Maintain proper protein folding as much as possible, recognizing that membrane proteins like RnfE may have conformational epitopes that are dependent on their native membrane environment.

  • Immunization Protocol Selection:

    • For polyclonal antibodies: Multiple immunizations with adjuvants in rabbits or other suitable animals

    • For monoclonal antibodies: Consider mouse hybridoma technology or phage display

  • Epitope Selection: Identify unique regions of RnfE that don't share homology with other proteins to ensure specificity, particularly considering the relatedness of Shigella sonnei to other Enterobacteriaceae.

  • Validation Methods:

    • Western blotting against both recombinant protein and native protein in bacterial lysates

    • Immunoprecipitation to confirm antibody-protein interaction

    • Immunofluorescence microscopy to verify cellular localization

    • ELISA to determine antibody titer and specificity

  • Cross-Reactivity Testing: Evaluate potential cross-reactivity with homologous proteins from related bacterial species, especially E. coli which is closely related to Shigella sonnei.

  • Storage Considerations: Antibodies should be stored according to validated protocols, typically at -20°C with appropriate preservatives to maintain activity over time.

How can researchers investigate the potential of RnfE as a therapeutic target against Shigella sonnei infections?

Investigating RnfE as a potential therapeutic target against Shigella sonnei infections requires a systematic approach:

  • Target Validation Studies:

    • Generate RnfE knockout mutants in S. sonnei to assess viability and virulence

    • Evaluate growth kinetics under various conditions to determine the essentiality of RnfE

    • Assess in vivo virulence of RnfE-deficient strains in appropriate animal models

  • High-Throughput Screening Approaches:

    • Develop enzymatic assays to measure RnfE activity suitable for screening compound libraries

    • Utilize bacterial growth assays with reporter systems linked to RnfE function

    • Employ computational docking studies to identify potential inhibitors based on RnfE structure

  • Lead Compound Characterization:

    • Determine mechanism of action for identified inhibitors

    • Assess specificity against RnfE versus other bacterial proteins

    • Evaluate cytotoxicity against mammalian cells to establish therapeutic window

  • Resistance Development Assessment:

    • Conduct serial passage experiments to evaluate the potential for resistance development

    • Identify potential resistance mechanisms through whole-genome sequencing of resistant isolates

    • Design combination approaches to minimize resistance emergence

  • Synergy Studies:

    • Evaluate potential synergistic effects between RnfE inhibitors and existing antibiotics

    • Test combinations against different Shigella strains, particularly those with established antibiotic resistance

This is particularly relevant given that S. sonnei has demonstrated increasing antibiotic resistance globally, with resistance to fluoroquinolones, third-generation cephalosporins, and azithromycin already reported .

How does RnfE function coordinate with Shigella sonnei's virulence mechanisms?

While RnfE primarily functions in electron transport and energy generation, its role can be integrated with our understanding of S. sonnei's virulence mechanisms:

  • Energy Requirements for Virulence Gene Expression: The expression and function of virulence factors, including the Type VI Secretion System (T6SS) that gives S. sonnei competitive advantage over other gut bacteria, require sufficient energy production to which RnfE contributes .

  • Adaptation to Host Environment: During infection, S. sonnei must adapt to varying oxygen levels and nutrient conditions within the host. The electron transport chain components, including RnfE, may be differentially regulated to optimize energy production under these changing conditions.

  • Stress Response Coordination: S. sonnei has demonstrated enhanced adaptation to oxidative stress, which contributes to its global dominance . The electron transport chain is intimately connected with oxidative stress management through maintaining redox balance.

  • Integration with O-Antigen Function: S. sonnei's unique O-antigen structure contributes significantly to its virulence by resisting phagolysosomal acidification and enhancing neutrophil cell death . The synthesis and maintenance of these structures require energy provided by electron transport processes.

Research approaches to investigate these connections could include:

  • Transcriptomic analysis correlating RnfE expression with virulence factor expression under various conditions

  • Metabolic flux analysis to determine energy allocation during virulence factor production

  • In vivo competition assays between wild-type and RnfE-mutant strains

What are the comparative differences between RnfE in Shigella sonnei versus other Enterobacteriaceae?

Understanding the evolutionary and functional differences of RnfE across related bacterial species provides valuable insights:

SpeciesRnfE CharacteristicsFunctional Implications
Shigella sonnei231 amino acids, part of complete Rnf complexContributes to efficient energy production, potentially supporting virulence mechanisms
Shigella flexneriHigh sequence similarity, but may have functional differencesMay contribute to differing virulence strategies between Shigella species
Escherichia coliHomologous protein with similar functionTarget of S. sonnei competitive mechanisms via T6SS
Other EnterobacteriaceaeVariable conservationCould explain different niche adaptations

Research methodologies to explore these differences should include:

  • Comparative genomic analysis of rnfE gene sequences and the entire rnf operon structure

  • Heterologous expression studies to determine functional interchangeability

  • Structural comparison of purified proteins from different species

  • Evolutionary analysis to trace acquisition and modification of the rnf system

This comparative approach is particularly relevant given that S. sonnei has been found to outcompete other Enterobacteriaceae, including S. flexneri and E. coli, partly due to its T6SS , suggesting potential differences in core metabolic functions as well.

How might advances in structural biology techniques enhance our understanding of RnfE function?

Recent advances in structural biology offer promising approaches to elucidate RnfE structure and function:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology, potentially allowing visualization of RnfE within the complete Rnf complex without crystallization.

  • Integrative Structural Biology: Combining multiple techniques such as X-ray crystallography, NMR spectroscopy, and computational modeling to overcome limitations of individual methods.

  • AlphaFold and AI-Driven Structure Prediction: Deep learning approaches have significantly improved protein structure prediction, which could provide insights into RnfE structure even with limited experimental data.

  • In-Cell NMR: Emerging techniques for studying protein structure and dynamics within the cellular environment could provide insights into RnfE function in near-native conditions.

  • Time-Resolved Structural Studies: Methods to capture different conformational states during the electron transport process could elucidate the mechanism of action.

Future research should prioritize:

  • Determining the high-resolution structure of RnfE individually and within the complete Rnf complex

  • Identifying conformational changes associated with electron transport

  • Mapping interaction interfaces with other complex components

  • Correlating structural features with functional properties

What emerging biotechnological applications might utilize RnfE or the Rnf complex?

The study of RnfE and the Rnf complex opens possibilities for novel biotechnological applications:

  • Bioelectrochemical Systems: The electron transport capabilities of the Rnf complex could be exploited in microbial fuel cells or bioelectrosynthesis platforms.

  • Synthetic Biology Tools: Engineered Rnf complexes could serve as modular components in synthetic electron transport chains designed for specific biotechnological processes.

  • Diagnostic Applications: Antibodies against unique epitopes of Shigella sonnei RnfE could be developed into diagnostic tools for rapid detection of this pathogen.

  • Vaccine Development: Understanding RnfE structure and conservation across strains could contribute to rational vaccine design approaches targeting metabolic vulnerabilities.

  • Bioremediation Technologies: Engineered bacteria with modified electron transport chains containing optimized Rnf complexes could enhance degradation of environmental pollutants.

  • Drug Screening Platforms: The established recombinant expression and purification methods for RnfE provide a foundation for developing high-throughput screening systems to identify novel antimicrobial compounds.

Research directions in this area should focus on:

  • Optimizing expression and stability of RnfE for various applications

  • Characterizing electron transport capabilities under different conditions

  • Developing immobilization strategies for bioelectrochemical applications

  • Exploring potential for protein engineering to enhance desired functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.