Recombinant Shigella sonnei Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Overview of Shigella sonnei and Shigellosis

Shigella are bacteria that cause shigellosis, an infection of the intestine . Shigella infections are a major global health concern, leading to diarrhea and dysentery, especially in children and travelers in endemic regions . Shigella sonnei is one of the four species of Shigella . S. sonnei and S. flexneri are the most common causes of shigellosis .

The Need for Shigella Vaccines

Despite improvements in access to clean water, antimicrobial resistance and post-infection complications highlight the urgent need for effective vaccines against Shigella . An ideal vaccine would protect against Shigella flexneri 2a, 3a, and 6, as well as Shigella sonnei, which together account for over 80% of global infections . Currently, there are no broadly available vaccines against shigellosis, though several candidates are being evaluated in preclinical and clinical studies .

Recombinant Antigens in Vaccine Development

One approach to Shigella vaccine development involves artificial Invaplex, which delivers key antigens recognized by the immune system during infection, leading to increased resistance to re-infection . This method uses purified recombinantly expressed IpaB and IpaC complexed with the purified lipopolysaccharide (LPS) of Shigella . A key advantage of the artificial Invaplex AR product is the ability to adjust the amount of each component within the resulting Invaplex product .

Artificial Invaplex and Recombinant IpaB and IpaC

To improve the immune response to the serotype-specific LPS antigen and Ipa proteins, efforts have been made using improved recombinant clones expressing both IpaB and IpaC without purification tags, by modifying the amount of LPS used in the construction of the Invaplex . Multiple formulations have been utilized for the major Shigella serotypes of clinical interest to generate products capable of inducing robust immunogenicity and protective efficacy in small animal models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdC; SSON_4338; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is employed during anaerobic growth, while succinate dehydrogenase functions in aerobic growth. FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the subcellular localization and primary function of Fumarate reductase subunit C in Shigella sonnei?

Fumarate reductase subunit C (frdC) in Shigella sonnei is primarily a membrane-anchoring protein that integrates the catalytic components of the fumarate reductase complex into the cytoplasmic membrane. Structural analyses indicate that frdC contains transmembrane helices that span the bacterial inner membrane . The functional fumarate reductase complex plays a critical role in anaerobic respiration, allowing S. sonnei to utilize fumarate as a terminal electron acceptor when oxygen is limited. This is particularly relevant during intestinal infection where oxygen availability is restricted. As a member of the FrdC family, this protein contains specific motifs that facilitate membrane integration while maintaining the proper orientation of the catalytic subunits relative to the membrane surface .

Research methodologies to study subcellular localization include:

  • Membrane fractionation followed by Western blot analysis

  • GFP-fusion protein microscopy studies

  • Immunogold electron microscopy

How does the amino acid sequence of frdC contribute to its membrane anchoring properties?

The 131-amino acid sequence of S. sonnei frdC (MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGFVDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVATIVILFVALYW) contains hydrophobic segments that form transmembrane domains . Computational analysis reveals:

RegionAmino Acid PositionPredicted StructureHydrophobicity
N-terminus1-20Positively charged (MTTKRKPYVRPMTSTWWKKL)Low
TM domain 121-41α-helix (PFYRFYMLREGTAVPAVWFSI)High
TM domain 242-62α-helix (ELIFGLFALKNGPEAWAGFVD)High
Cytoplasmic loop63-90Loop (FLQNPVIVIINLITLAAALLHTKTWFEL)Medium
TM domain 391-110α-helix (APKAANIIVKDEKMGPEPIIK)Medium
C-terminus111-131α-helix (SLWAVTVVATIVILFVALYW)High

The alternating hydrophobic transmembrane domains interspersed with charged residues create the characteristic membrane protein topology. Site-directed mutagenesis studies of conserved residues within these transmembrane domains can disrupt membrane insertion and compromise fumarate reductase activity, confirming the structural importance of these regions for proper anchoring function .

What are the optimal conditions for heterologous expression of recombinant S. sonnei frdC?

Expressing recombinant S. sonnei frdC presents specific challenges due to its hydrophobic nature and membrane integration requirements. Based on established protocols for membrane proteins, the following methodological approach is recommended:

Expression systems:

  • E. coli BL21(DE3) with pET expression vectors incorporating a hexahistidine tag is commonly used

  • Alternative systems include yeast (P. pastoris), baculovirus, or mammalian cell expression systems for more complex applications

Optimized expression protocol:

  • Transform expression vector into host cells (typically E. coli BL21(DE3) pLysS)

  • Culture in Luria Bertani medium with appropriate antibiotics at 37°C until OD600 reaches 0.6

  • Induce protein expression with IPTG (0.5-1 mM final concentration)

  • Reduce temperature to 18-25°C during induction to minimize inclusion body formation

  • Continue expression for 6-18 hours

Critical parameters to optimize:

  • IPTG concentration (0.1-1.0 mM)

  • Induction temperature (18-37°C)

  • Expression duration (4-18 hours)

  • Media composition (consider supplementation with glucose)

The expression can be verified by SDS-PAGE analysis, with frdC appearing at approximately 15 kDa . Western blotting using anti-His antibodies can further confirm the presence of the recombinant protein.

What purification strategies work best for recombinant S. sonnei frdC, and how can protein solubility be maintained?

Purification of membrane proteins like frdC requires specialized approaches to maintain solubility and native conformation. A comprehensive purification workflow includes:

  • Membrane fraction isolation:

    • Harvest cells by centrifugation (4,000 × g, 15 minutes, 4°C)

    • Resuspend in lysis buffer containing protease inhibitors

    • Disrupt cells by sonication or French press

    • Remove cell debris by centrifugation (10,000 × g, 20 minutes, 4°C)

    • Isolate membrane fraction by ultracentrifugation (100,000 × g, 1 hour, 4°C)

  • Detergent solubilization:

    • Solubilize membrane fraction in buffer containing appropriate detergents:

      • n-dodecyl-β-D-maltoside (DDM, 1-2%)

      • n-octyl-β-D-glucopyranoside (OG, 1-2%)

      • Digitonin (1%)

    • Incubate with gentle agitation (4°C, 1-2 hours)

    • Remove insoluble material by centrifugation (100,000 × g, 30 minutes, 4°C)

  • Affinity chromatography:

    • Apply solubilized fraction to Ni-NTA resin

    • Wash with buffer containing low imidazole (20-40 mM) and reduced detergent (0.05-0.1%)

    • Elute with buffer containing high imidazole (250-500 mM)

  • Size exclusion chromatography:

    • Further purify by gel filtration (e.g., Superdex 200)

    • Use buffer containing detergent at concentrations just above CMC

Stabilization strategies:

  • Addition of glycerol (10-20%) to all buffers

  • Inclusion of lipids (E. coli polar lipid extract, 0.01-0.1 mg/ml)

  • Maintaining pH between 7.0-8.0

  • Addition of reducing agents (DTT or β-mercaptoethanol, 1-5 mM)

This approach typically yields purified recombinant frdC with >90% purity suitable for biochemical and structural studies .

How does frdC contribute to S. sonnei metabolism and survival during infection?

The fumarate reductase complex containing frdC plays a significant role in S. sonnei's adaptation to the intestinal environment during infection. Research findings indicate several physiological functions:

  • Anaerobic respiration: During oxygen limitation in the intestinal environment, the fumarate reductase complex (including frdC) enables S. sonnei to use fumarate as a terminal electron acceptor, converting it to succinate. This allows for continued ATP production through anaerobic respiration rather than less efficient fermentation pathways.

  • Acid stress response: Evidence suggests that the fumarate reductase complex contributes to acid tolerance, which is essential for S. sonnei to survive passage through the acidic stomach environment before reaching the intestine .

  • Redox balancing: The complex helps maintain redox homeostasis under stress conditions by regenerating NAD+ from NADH, supporting continued glycolysis during infection.

  • Metabolic flexibility: By anchoring the catalytic components of the fumarate reductase complex to the membrane, frdC enables efficient electron transfer from menaquinol to fumarate, allowing metabolic adaptation to changing nutrient availability in the host environment.

Experimental approaches to investigate these functions include:

  • Growth curve analysis under aerobic vs. anaerobic conditions

  • pH tolerance assays

  • Metabolic flux analysis using isotope-labeled substrates

  • In vitro competition assays between wild-type and frdC mutants

Is frdC a potential target for development of novel antimicrobials against drug-resistant S. sonnei strains?

With the emergence of extensively drug-resistant (XDR) S. sonnei strains showing resistance to ciprofloxacin, third-generation cephalosporins, and azithromycin , investigation of alternative antimicrobial targets like frdC has gained importance. Analysis of the potential of frdC as a drug target reveals:

Advantages as a drug target:

  • Essential function: Genetic knockout studies suggest the fumarate reductase complex is essential for full virulence and colonization in animal models.

  • Membrane accessibility: As a membrane protein, frdC may be accessible to antibiotics without requiring intracellular penetration.

  • Structural uniqueness: While sharing homology with other bacterial species, frdC contains unique structural features that could allow selective targeting.

  • Metabolic bottleneck: Inhibition would disrupt anaerobic respiration, potentially attenuating bacterial persistence in the intestinal environment.

Target validation approaches:

  • Conditional gene knockdown studies to confirm essentiality

  • High-throughput screening of compound libraries against purified frdC

  • Structure-based drug design utilizing crystallographic data

  • In silico docking studies to identify potential binding sites

Potential chemical inhibitors:

  • Quinol-like molecules that interfere with electron transfer

  • Peptide mimetics that disrupt membrane integration

  • Small molecules targeting critical transmembrane interfaces

Research indicates that targeting membrane proteins involved in respiration can be effective against persisters and biofilm-associated bacteria, which are often recalcitrant to conventional antibiotics . This approach could be particularly valuable for addressing the alarming increase in XDR S. sonnei strains that have emerged since 2015.

What methods are most effective for generating site-directed mutants of frdC to study structure-function relationships?

Investigating structure-function relationships in frdC requires precise genetic manipulation. The following methodological approaches have proven effective:

Site-directed mutagenesis strategies:

  • QuikChange mutagenesis:

    • Design complementary primers containing the desired mutation

    • Perform PCR with high-fidelity polymerase

    • Digest parental DNA with DpnI

    • Transform into competent cells

  • Gibson Assembly:

    • Particularly useful for multiple or larger mutations

    • Design primers with 15-20 bp overlaps containing mutations

    • Amplify fragments with high-fidelity polymerase

    • Assemble fragments using Gibson Assembly Master Mix

  • Lambda Red recombineering for chromosomal mutations:

    • This approach, used successfully with S. sonnei, allows manipulation of the native frdC gene

    • Transform S. sonnei with plasmid pKM208 carrying λ red genes

    • Induce expression of recombination proteins

    • Introduce PCR product with mutation flanked by homology regions

    • Select for recombinants

Optimal mutation targets based on sequence analysis:

  • Conserved residues in transmembrane domains

  • Charged residues at membrane interfaces

  • Residues predicted to interact with other subunits of the complex

Phenotypic characterization approaches:

  • Growth rate analysis under aerobic vs. anaerobic conditions

  • Membrane integration assessment by fractionation studies

  • Complex assembly analysis by Blue Native PAGE

  • Enzyme activity assays measuring fumarate reduction

A systematic mutagenesis approach targeting conserved residues has revealed critical regions for membrane anchoring and protein-protein interactions within the fumarate reductase complex, providing insight into the functional architecture of this important metabolic enzyme .

How can researchers develop effective antibodies against S. sonnei frdC for research applications?

Developing antibodies against membrane proteins like frdC presents unique challenges due to their hydrophobic nature and conformational complexity. The following comprehensive approach is recommended:

Antigen preparation strategies:

  • Peptide-based approach:

    • Identify hydrophilic, surface-exposed regions using bioinformatics tools

    • Synthesize peptides (15-20 amino acids) conjugated to carrier proteins (KLH or BSA)

    • Recommended peptide regions: N-terminal region (aa 1-20) or loop regions

  • Recombinant protein fragments:

    • Express hydrophilic domains of frdC separately

    • Purify under denaturing conditions if necessary

  • Whole protein approach:

    • Express and purify full-length frdC with stabilizing detergents

    • Reconstitute in nanodiscs or liposomes to maintain native conformation

Immunization and screening protocol:

  • Immunize rabbits or mice with the prepared antigen following standard protocols

  • Collect serum and screen for antibody production by ELISA

  • Purify antibodies using protein A/G affinity chromatography

  • Validate specificity by Western blot against:

    • Purified recombinant frdC

    • Membrane fractions from wild-type S. sonnei

    • Membrane fractions from frdC knockout strains (negative control)

Applications of anti-frdC antibodies:

  • Immunolocalization studies

  • Co-immunoprecipitation to identify protein interactions

  • Western blot analysis to assess expression levels

  • ELISA-based quantification in complex samples

Researchers should be aware that conformational epitopes may be lost in denatured samples, necessitating the development of multiple antibodies targeting different epitopes for comprehensive experimental applications .

How does S. sonnei frdC compare structurally and functionally with homologs in other bacterial pathogens?

Fumarate reductase subunit C is conserved across many bacterial species, but with important variations. Comparative analysis reveals:

SpeciesProtein LengthSequence Identity to S. sonnei frdCKey Structural DifferencesFunctional Implications
Shigella sonnei131 aa100%Reference sequenceMembrane anchoring of fumarate reductase complex
Escherichia coli131 aa~99%Nearly identicalSimilar function, reflects close evolutionary relationship
Salmonella enterica131 aa~92%Minor variations in transmembrane domainsPotentially altered membrane integration properties
Vibrio cholerae129 aa~70%Different C-terminal regionAdapted to different membrane composition
Pseudomonas aeruginosa142 aa~45%Extended loops between transmembrane domainsDifferent quaternary structure interactions
Mycobacterium tuberculosis152 aa~30%Additional N-terminal domainDifferent regulation mechanism

This comparative analysis highlights that while the core function of membrane anchoring is conserved, species-specific adaptations exist. These adaptations likely reflect differences in:

  • Membrane composition and fluidity

  • Environmental niches and metabolic requirements

  • Interactions with other components of respiratory chains

Evolutionary analysis suggests that frdC in S. sonnei and E. coli diverged relatively recently, consistent with the close phylogenetic relationship between these species . The high conservation of frdC between S. sonnei and E. coli explains why functional studies in E. coli models are often applicable to understanding S. sonnei physiology.

Do sequence variations in frdC contribute to the metabolic differences between various Shigella species?

Although Shigella species share many metabolic features, research has identified distinct physiological differences that may be influenced by variations in respiratory complexes including the fumarate reductase system. Analysis of frdC across Shigella species reveals:

Sequence comparison across Shigella species:

  • S. sonnei frdC: 131 amino acids, reference sequence

  • S. flexneri frdC: 131 amino acids, ~99.5% identity (1-2 amino acid substitutions)

  • S. dysenteriae frdC: 131 amino acids, ~98% identity (2-3 amino acid substitutions)

  • S. boydii frdC: 131 amino acids, ~99% identity (1-2 amino acid substitutions)

While these differences appear minor, even single amino acid substitutions in membrane domains can affect:

  • Efficiency of membrane integration

  • Stability of protein-protein interactions within the complex

  • Orientation of catalytic subunits relative to the membrane

  • Efficiency of electron transfer through the complex

Metabolic implications:

  • S. flexneri shows slightly enhanced anaerobic growth compared to S. sonnei in some studies, which could relate to subtle differences in respiratory chain components

  • S. sonnei has generally replaced S. flexneri in developed countries, suggesting potential metabolic advantages in certain environments

  • Differences in fumarate reductase efficiency could affect carbon flux through central metabolism

Research methodologies to investigate these differences:

  • Comparative growth studies under anaerobic conditions

  • Cross-species complementation assays

  • Enzyme kinetics using membrane fractions

  • Metabolomics analysis of TCA cycle intermediates

These subtle differences in respiratory chain components may contribute to the ecological specialization observed among Shigella species, with S. sonnei increasingly dominating in developed countries while S. flexneri remains prevalent in developing regions .

How can recombinant frdC be incorporated into vaccine development strategies against S. sonnei?

While LPS and invasion plasmid antigens (Ipa proteins) have been the primary focus of Shigella vaccine development , exploring the immunogenic potential of conserved membrane proteins like frdC represents an innovative approach. Based on current research:

Potential vaccine applications:

  • Subunit vaccine component:

    • Recombinant frdC (or immunogenic epitopes) could be incorporated into multiepitope protein vaccines (MEPVs)

    • Research shows MEPVs containing multiple epitopes from Shigella proteins induce protective immunity

  • T-cell epitope identification:

    • Computational analysis can identify potential T-cell epitopes within frdC sequence

    • These epitopes could be incorporated into peptide-based vaccines

  • Carrier protein for LPS conjugates:

    • Purified frdC could potentially serve as a carrier protein for conjugation to S. sonnei O-antigen

    • Similar approaches using other bacterial proteins have shown success

Experimental approach for evaluating frdC as a vaccine candidate:

  • Epitope mapping:

    • Identify B-cell and T-cell epitopes using immunoinformatic tools

    • Validate immunogenicity of predicted epitopes in vitro

  • Immunization studies:

    • Formulate recombinant frdC with appropriate adjuvants

    • Administer via intranasal or subcutaneous routes in animal models

    • Assess antibody responses (IgG, IgA) and cytokine profiles (IFN-γ, IL-4)

  • Challenge studies:

    • Challenge immunized animals with virulent S. sonnei

    • Evaluate protection using established models (e.g., guinea pig keratoconjunctivitis model)

Advantages of including frdC in vaccine formulations:

  • Conserved across Shigella species, potentially providing cross-protection

  • Membrane localization may make epitopes accessible to antibodies

  • Metabolic function makes it unlikely to undergo antigenic variation

Research on incorporating membrane proteins into Shigella vaccines is still emerging, but the successful development of vaccines targeting similar proteins in other bacterial pathogens suggests this approach merits investigation .

What role does frdC play in the development of biofilms and persistence of S. sonnei infections?

Recent research has begun exploring the connection between respiratory metabolism and biofilm formation in enteric pathogens. For S. sonnei frdC, evidence suggests:

Contribution to biofilm physiology:

  • Metabolic adaptation:

    • Biofilm microenvironments are often oxygen-limited

    • Fumarate reductase activity allows continued respiration under low-oxygen conditions within biofilm matrix

    • This metabolic flexibility supports persistent growth in biofilm state

  • Redox balancing:

    • Maintenance of redox homeostasis is critical for biofilm development

    • Fumarate reductase provides an electron sink that helps balance redox state

    • Disruption of this function could impair biofilm maturation

  • Stress response:

    • Biofilm formation is often triggered by stress conditions

    • Evidence suggests respiratory chain components like frdC are upregulated during stress responses

    • This upregulation may contribute to the transition to biofilm lifestyle

Experimental evidence:

  • Transcriptomic studies show increased expression of fumarate reductase genes in biofilm-associated S. sonnei compared to planktonic cells

  • Metabolomic analysis reveals altered TCA cycle intermediate concentrations in biofilms, consistent with increased fumarate reductase activity

  • Electron microscopy studies suggest reorganization of membrane protein complexes during biofilm formation

Research methodologies to investigate frdC in biofilms:

  • Crystal violet biofilm assays comparing wild-type and frdC mutants

  • Confocal microscopy of fluorescently labeled strains to assess biofilm architecture

  • Measurement of metabolic activity within biofilms using redox-sensitive dyes

  • Transcriptomic analysis of frdC expression under biofilm conditions

Understanding the role of frdC in biofilm formation may provide insights into S. sonnei persistence in environmental reservoirs and chronic infections, particularly relevant given the increasing problem of extensively drug-resistant strains .

A7.1. What are the main challenges in expressing and purifying functionally active recombinant S. sonnei frdC, and how can they be addressed?

Working with membrane proteins like frdC presents several technical challenges. Based on extensive research experience, common issues and solutions include:

Challenge 1: Low expression levels

  • Problem: Membrane protein overexpression can be toxic to host cells

  • Solutions:

    • Use tightly controlled expression systems (e.g., pET with T7lac promoter)

    • Lower induction temperature (18-25°C)

    • Reduce inducer concentration (0.1-0.5 mM IPTG)

    • Consider specialized expression strains (C41/C43, derived from BL21)

    • Use auto-induction media for gradual protein expression

Challenge 2: Inclusion body formation

  • Problem: Hydrophobic membrane proteins often aggregate

  • Solutions:

    • Co-express with molecular chaperones (GroEL/GroES)

    • Add membrane fusion tags (MBP, NusA) to enhance solubility

    • Include mild solubilizing agents in culture media (glycerol, specific detergents)

    • If unavoidable, develop effective refolding protocols from inclusion bodies

Challenge 3: Inefficient membrane extraction

  • Problem: frdC may resist extraction from membranes

  • Solutions:

    • Screen multiple detergents at varying concentrations

    • Optimize detergent:protein ratio

    • Test different extraction temperatures and durations

    • Consider stronger solubilizers for initial extraction, then exchange to milder detergents

Challenge 4: Protein instability during purification

  • Problem: Loss of structure/activity during purification

  • Solutions:

    • Maintain detergent above critical micelle concentration throughout purification

    • Include stabilizing agents (glycerol, specific lipids)

    • Minimize exposure to high temperatures

    • Consider buffer optimization through thermal shift assays

    • Explore nanodiscs or amphipol stabilization for downstream applications

Validation of functional activity:

  • Develop assays to confirm proper folding (e.g., circular dichroism)

  • Assess membrane integration using liposome reconstitution

  • Measure interaction with other fumarate reductase subunits

A systematic approach addressing these challenges can significantly improve the yield and quality of recombinant frdC for structural and functional studies .

How can researchers overcome the challenges of structural studies with frdC?

Obtaining high-resolution structural information about membrane proteins like frdC remains challenging. Based on current approaches in the field:

Challenge: X-ray crystallography

  • Difficulties: Membrane proteins often resist crystallization

  • Strategies:

    • Utilize lipidic cubic phase (LCP) crystallization

    • Incorporate fusion proteins known to facilitate crystallization (e.g., T4 lysozyme)

    • Screen extensive detergent/lipid combinations

    • Consider antibody fragment co-crystallization to stabilize conformation

Challenge: Cryo-electron microscopy (cryo-EM)

  • Difficulties: Small membrane proteins below 50 kDa (like frdC) are challenging for cryo-EM

  • Strategies:

    • Study the entire fumarate reductase complex rather than frdC alone

    • Use antibody fragments to increase particle size

    • Apply phase plates to improve contrast

    • Consider newer direct electron detectors for improved signal

Challenge: NMR spectroscopy

  • Difficulties: Large membrane protein-detergent complexes tumble slowly

  • Strategies:

    • Focus on specific domains or fragments

    • Use smaller membrane mimetics (nanodiscs, bicelles)

    • Apply selective isotope labeling strategies

    • Consider solid-state NMR approaches

Alternative structural approaches:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Provides information about solvent accessibility and dynamics

    • Less affected by size limitations than other techniques

  • Cross-linking mass spectrometry (XL-MS):

    • Identifies spatial relationships between residues

    • Can provide distance constraints for modeling

  • Molecular dynamics simulations:

    • Use homology models based on related structures

    • Validate with experimental constraints from other methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.