Recombinant Shigella sonnei Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its implementation.
Synonyms
frdD; SSON_4337; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGIVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate. Fumarate reductase is employed during anaerobic growth, while succinate dehydrogenase functions in aerobic conditions. FrdD anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Fumarate reductase subunit D (frdD) in Shigella sonnei and what is its function?

Fumarate reductase subunit D (frdD) is a small hydrophobic protein component of the fumarate reductase enzyme complex in Shigella sonnei. This 119-amino acid protein serves as a membrane anchor subunit that helps attach the catalytic components of the enzyme to the bacterial membrane . The fumarate reductase complex plays a crucial role in anaerobic respiration by catalyzing the reduction of fumarate to succinate, allowing the bacterium to use fumarate as a terminal electron acceptor when oxygen is limited or absent.

The fumarate reductase complex consists of four subunits (FrdA, FrdB, FrdC, and FrdD), with FrdD being the smallest. Together with FrdC, it forms the membrane anchor domain that secures the catalytic subunits (FrdA and FrdB) to the cytoplasmic membrane while also participating in electron transfer from the quinone pool to the catalytic site.

What are the optimal conditions for expression and purification of recombinant S. sonnei frdD?

Due to its hydrophobic nature and membrane association, special techniques are required for successful expression and purification of recombinant S. sonnei frdD:

Expression system optimization:

  • E. coli BL21(DE3) or similar strains optimized for membrane protein expression

  • Expression vectors with inducible promoters (T7) and fusion tags (His-tag is commonly used)

  • Lower induction temperature (16-25°C) to improve folding

  • Extended induction time (overnight to 24 hours)

  • Addition of glycerol (0.5-1%) to the culture medium

Purification protocol:

  • Gentle cell lysis using French press or sonication with cooling

  • Isolation of membrane fraction through ultracentrifugation

  • Solubilization with mild detergents (n-dodecyl-β-D-maltoside, LDAO, or Triton X-100)

  • Immobilized metal affinity chromatography using His-tag

  • Size exclusion chromatography for final purification

  • Storage in buffer containing 50% glycerol at -20°C or -80°C, with aliquoting to avoid freeze-thaw cycles

Commercial preparations typically achieve >90% purity as determined by SDS-PAGE .

How can researchers confirm the identity and functionality of purified recombinant frdD?

Multiple analytical methods should be employed to confirm the identity and functionality of purified recombinant frdD:

Analytical verification:

  • SDS-PAGE to confirm expected molecular weight (~13 kDa)

  • Western blotting with anti-His antibodies or specific antibodies against frdD

  • Mass spectrometry for precise molecular weight determination and sequence confirmation

  • Circular dichroism to verify secondary structure content, particularly alpha-helical content expected for membrane proteins

Functional verification:

  • Reconstitution into liposomes to confirm membrane integration

  • Co-purification assays with other fumarate reductase subunits to verify complex formation

  • Enzyme activity assays measuring fumarate reduction when combined with other subunits

  • Quinone binding assays to assess interaction with electron carriers

How does frdD compare between different Shigella species and strains?

Comparative analysis reveals high conservation of frdD across Shigella species:

SpeciesLength (aa)Molecular Weight (kDa)Sequence Identity to S. sonneiNumber of TMDs
S. sonnei119~13Reference3
S. boydii119~13~98%3
S. flexneri119~13~99%3
S. dysenteriae119~13~97%3

The high sequence conservation reflects the essential metabolic function of frdD, which contrasts sharply with the higher variability seen in virulence factors and resistance determinants across Shigella species . The core functional domains, particularly the transmembrane regions, show the highest conservation. This conservation suggests functional interchangeability of frdD proteins between Shigella species.

How has the frdD gene evolved across different lineages of Shigella sonnei?

S. sonnei has five main lineages (L1-L5), with Lineage 3 being globally dominant . Genomic studies of diverse S. sonnei isolates show that core metabolic genes like frdD exhibit minimal variation between lineages, despite significant differences in virulence plasmids and resistance profiles :

  • Single nucleotide polymorphisms (SNPs) in frdD, when present, tend to be synonymous, preserving amino acid sequence

  • Extremely low dN/dS ratios indicate strong purifying selection

  • Insertions/deletions are extremely rare in frdD across all lineages

  • This conservation pattern contrasts with rapid evolution of resistance determinants in the same lineages

While virulence plasmids show extensive horizontal gene transfer between lineages , chromosomal genes like frdD primarily evolve through vertical inheritance. The conservation across diverse geographic isolates and over extended time periods highlights the evolutionary stability of this metabolic function.

What role does frdD play in Shigella sonnei metabolism and pathogenesis?

The fumarate reductase complex, including frdD, plays several important roles in S. sonnei metabolism and potentially in pathogenesis:

Metabolic contributions:

  • Anaerobic respiration: Enables S. sonnei to use fumarate as a terminal electron acceptor when oxygen is limited, allowing continued energy generation

  • Reverse TCA cycle operation: Under certain conditions, contributes to reverse flow through parts of the TCA cycle

  • Energy conservation: Ensures efficient coupling of fumarate reduction to proton translocation by anchoring catalytic components correctly

Potential roles in pathogenesis:

  • Adaptation to intestinal environment: The intestinal lumen is relatively anaerobic, and fumarate reductase likely contributes to bacterial survival in this niche

  • Intracellular metabolism: Research on S. flexneri demonstrates that metabolism significantly changes during intracellular growth, with evidence that the mixed-acid fermentation pathway is required for intracellular growth and spread

  • Response to stress conditions: The proteome of intracellular Shigella reveals adaptations to iron limitation and oxidative stress, processes that may involve fumarate reductase

Research on S. flexneri has confirmed that metabolic adaptation, including pathways connected to anaerobic respiration, is essential for intracellular growth and spread , suggesting that frdD may contribute to S. sonnei virulence through its role in metabolic adaptation.

How does frdD expression change during infection and under different environmental conditions?

The expression of frdD responds dynamically to environmental cues that S. sonnei encounters during infection:

Oxygen-dependent regulation:

  • Anaerobic conditions strongly induce frdD expression through the FNR (fumarate and nitrate reduction) transcription factor

  • Microaerobic environments, such as those in the intestine, lead to intermediate expression levels

Host-associated conditions affecting expression:

  • Iron limitation affects expression due to the iron-sulfur clusters in the fumarate reductase complex

  • Acidic environments (such as those encountered during passage through the stomach or in phagosomes) may alter frdD expression

Intracellular expression patterns:

  • Research on the S. flexneri intracellular proteome suggests that metabolic enzymes related to anaerobic respiration show altered abundance during infection

  • The transition from extracellular to intracellular environments triggers expression changes in metabolic genes as part of bacterial adaptation

Experimental approaches to study these expression changes include RT-qPCR, RNA-Seq for genome-wide expression analysis, reporter systems with fluorescent proteins, and proteomic analysis as performed for S. flexneri .

What structural and functional interactions exist between frdD and other subunits of fumarate reductase?

The fumarate reductase complex in S. sonnei involves specific interactions between its four subunits that ensure proper assembly and function:

Key interactions involving frdD:

  • frdD-frdC interaction:

    • Forms a heterodimer through hydrophobic interactions between transmembrane helices

    • Creates a stable membrane anchor for the entire complex

    • The interface involves specific residues in the transmembrane domains

  • Quinone interaction:

    • The frdC-frdD anchor domain contains a quinone binding site

    • Facilitates electron transfer from the quinone pool to the catalytic subunits

  • Complex assembly:

    • frdD and frdC together create the membrane attachment point for frdA and frdB

    • Proper orientation is critical for electron transfer from membrane quinones to the catalytic site

Studies in related systems suggest that disruption of frdD-frdC interactions leads to enzyme instability and loss of function, highlighting the importance of these structural interactions for enzyme activity.

Could frdD be a potential target for antimicrobial development against multidrug-resistant Shigella sonnei?

With the emergence of extensively drug-resistant (XDR) S. sonnei strains , novel antimicrobial targets are urgently needed. Evaluating frdD as a potential target requires consideration of several factors:

Target validation criteria:

  • Conservation: frdD is highly conserved across Shigella species and related enterobacteria , suggesting limited mutation tolerance.

  • Essentiality: While not absolutely essential for aerobic growth, frdD is important for anaerobic growth and potentially for in vivo infection.

  • Druggability: As a membrane protein, frdD presents both challenges and opportunities:

    • Membrane proteins are often difficult targets for small molecules

    • The membrane location makes it potentially accessible from the periplasmic space

    • The protein-protein interfaces with other subunits offer potential binding sites

Potential therapeutic strategies:

  • Small molecules that disrupt frdD-frdC interactions

  • Compounds that prevent proper membrane insertion

  • Peptide mimetics that interfere with complex assembly

Advantages as a target:

  • Not targeted by current antibiotics, offering a novel mechanism

  • Potential activity against MDR S. sonnei strains due to orthogonal resistance mechanisms

  • Possible broad-spectrum activity against other enteric pathogens

Given the increasing prevalence of antimicrobial resistance in S. sonnei globally , including coresistance to ceftriaxone and azithromycin , novel targets like frdD warrant further investigation.

How does research on frdD fit into the broader context of S. sonnei as an emerging global pathogen?

Research on frdD and other metabolic components provides important context for understanding the emergence of S. sonnei as a dominant cause of shigellosis:

  • Evolutionary stability vs. plasmid dynamics:

    • While core metabolic genes like frdD remain highly conserved, S. sonnei virulence plasmids show extensive horizontal gene transfer and acquisition of resistance determinants

    • This contrast helps explain how S. sonnei maintains essential functions while rapidly adapting to selection pressures

  • Metabolic adaptation during pathogenesis:

    • S. sonnei is replacing S. flexneri as the dominant cause of shigellosis in many regions

    • Understanding metabolic adaptations may help explain this changing epidemiology

    • The Type VI secretion system allows S. sonnei to outcompete other Enterobacteriaceae , and metabolic adaptations may provide additional competitive advantages

  • Antimicrobial resistance context:

    • Extensively drug-resistant (XDR) S. sonnei has emerged globally

    • Understanding core metabolic processes may reveal novel therapeutic targets as alternatives to failing conventional antibiotics

  • Vaccine development implications:

    • Current vaccine development efforts focus primarily on O-antigen targets

    • Knowledge of conserved metabolic proteins could potentially inform alternative vaccination approaches

Research on frdD thus contributes to a more comprehensive understanding of S. sonnei biology beyond virulence factors and resistance determinants, potentially revealing new approaches to combat this emerging pathogen.

What methodological challenges exist in studying membrane proteins like frdD in Shigella?

Researchers face several significant challenges when working with membrane proteins like frdD in Shigella:

  • Protein stability issues:

    • Membrane proteins often become unstable when removed from their native lipid environment

    • Maintaining proper folding during purification requires careful optimization of detergents and buffer conditions

  • Expression challenges:

    • Overexpression of membrane proteins can be toxic to host cells

    • Inclusion body formation is common, necessitating refolding procedures

    • Obtaining sufficient quantities of properly folded protein requires extensive optimization

  • Difficulties specific to Shigella research:

    • S. sonnei spontaneously becomes avirulent during laboratory growth through loss of the virulence plasmid (pINV)

    • This instability complicates studies of membrane proteins in the context of pathogenesis

    • Recent research has identified mechanisms to improve plasmid maintenance , which may benefit frdD studies

  • Structural analysis limitations:

    • Obtaining high-resolution structures of membrane proteins requires specialized techniques

    • Crystallization of membrane proteins is notoriously difficult

    • Cryo-EM and other advanced methods may be necessary but require specialized equipment

  • Functional assay development:

    • Assessing function often requires reconstitution into artificial membrane systems

    • Creating physiologically relevant assay conditions that mimic the bacterial membrane environment is challenging

These methodological challenges explain why membrane proteins like frdD remain less studied than soluble proteins, despite their important roles in bacterial physiology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.