Recombinant Shigella sonnei Inner membrane protein CbrB (cbrB)

Shipped with Ice Packs
In Stock

Description

Production and Expression

PropertyDetails
Expression systemEscherichia coli (E. coli)
Source organismShigella sonnei (strain Ss046)
Purity>85% (SDS-PAGE)
FormulationTris-based buffer with 50% glycerol
Storage-20°C (short-term), -80°C (long-term); avoid repeated freeze-thaw

Functional and Research Context

While the exact biological role of CbrB in Shigella sonnei is not explicitly detailed in the provided sources, inner membrane proteins in Shigella species are often implicated in:

  • Virulence plasmid maintenance: Related proteins like MvpAT in Shigella flexneri stabilize plasmids through toxin-antitoxin systems .

  • Antimicrobial resistance: Shigella strains frequently harbor mobile genetic elements (e.g., IncFII plasmids) carrying resistance genes such as mphA and ermB .

Stability and Handling

  • Shelf life:

    • Liquid form: 6 months at -20°C/-80°C .

    • Lyophilized form: 12 months under the same conditions .

  • Usage notes: Working aliquots stored at 4°C retain stability for up to one week .

Research Gaps and Future Directions

  • Functional characterization: No studies in the reviewed sources elucidate CbrB’s role in virulence or metabolism.

  • Comparative genomics: Homologs in other Shigella species (e.g., S. flexneri) suggest potential involvement in plasmid-chromosome integration dynamics .

  • Antibiotic resistance linkage: Investigating whether cbrB co-occurs with macrolide resistance genes (e.g., mphA) could reveal novel resistance mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format preferences. Please indicate your requirements during order placement, and we will ensure your order is prepared accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be selected during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize its implementation.
Synonyms
cbrB; SSON_3560; Inner membrane protein CbrB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
cbrB
Target Protein Sequence
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLLVIIQVLPLFLLLSITTGAIP ALLTGVMVACLPEKIGSQKNYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGD SLVVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS
Uniprot No.

Target Background

Database Links
Protein Families
CbrB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does CbrB compare to similar proteins in other Shigella species and enteric pathogens?

Shigella is closely related to E. coli, suggesting potential homology between CbrB and proteins in related bacteria . Methodological analysis should include:

  • Bioinformatic comparison across bacterial species:

    • BLAST analysis against related enteric pathogens

    • Multiple sequence alignment to identify conserved domains

    • Phylogenetic analysis to establish evolutionary relationships

  • Comparative genomic analysis:

    • Examination of gene synteny (neighboring genes)

    • Functional domain conservation

    • Identification of species-specific modifications

  • Functional comparison through complementation studies:

    • Can homologs from other species complement cbrB mutations?

    • Do expression patterns differ between species?

    • Are there differences in protein localization?

What is the relationship between CbrB and Shigella virulence?

While specific information about CbrB's role in virulence is limited in available literature, methodological approaches to address this question include:

  • Gene knockout studies:

    • Create precise cbrB deletion mutants

    • Compare with wild-type in cell invasion assays

    • Assess virulence in appropriate animal models

  • Transcriptional analysis:

    • Determine if cbrB expression changes during infection

    • Compare expression in virulent vs. attenuated strains

    • Identify regulatory pathways controlling expression

  • Protein interaction studies:

    • Identify binding partners among known virulence factors

    • Map protein-protein interactions within the cell

Given that Shigella's pathogenicity involves complex mechanisms including invasion of intestinal epithelial cells, analysis of CbrB's potential role in membrane integrity, stress response, or interaction with host cells would be valuable .

What are the optimal expression systems and conditions for producing recombinant CbrB protein?

Recombinant CbrB protein can be produced using several expression systems, each with distinct advantages:

  • Bacterial expression (E. coli):

    • Use specialized strains designed for membrane proteins (C41/C43)

    • Consider lower induction temperatures (16-25°C)

    • Test various induction conditions (IPTG concentration, duration)

  • Alternative expression systems:

    • Yeast (P. pastoris) for eukaryotic processing

    • Baculovirus for higher yields of complex proteins

    • Mammalian cells for specific post-translational modifications

For membrane proteins like CbrB, expression optimization should include:

  • Screening different detergents for solubilization

  • Testing fusion tags that enhance folding and solubility

  • Evaluating co-expression with chaperones

Regardless of the system chosen, expression should be verified by Western blotting, and functional assays should confirm proper folding.

What purification strategies are most effective for CbrB?

Purifying membrane proteins requires specialized approaches:

  • Membrane fraction isolation:

    • Cell disruption in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using appropriate detergents

  • Chromatographic purification:

    • Affinity chromatography using tags (specific tag types determined during production)

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography to assess homogeneity

Throughout purification, it's essential to maintain an appropriate detergent concentration above the critical micelle concentration to prevent aggregation while preserving native structure.

What are the optimal storage conditions for maintaining CbrB stability?

According to product information, recombinant CbrB should be stored as follows:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots can be kept at 4°C for up to one week

  • Repeated freezing and thawing is not recommended

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized for stability . For long-term experiments, researchers should:

  • Aliquot the protein upon receipt to minimize freeze-thaw cycles

  • Include stability assessments (SDS-PAGE, functional assays) before critical experiments

  • Consider adding reducing agents if the protein contains reactive cysteines

  • Monitor protein quality through size exclusion chromatography to detect aggregation

How can researchers verify the functional integrity of purified CbrB?

Verifying membrane protein functionality presents unique challenges. Methodological approaches include:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to verify secondary structure

    • Thermal shift assays to assess stability

    • Limited proteolysis to confirm proper folding

  • Functional verification:

    • Reconstitution into proteoliposomes or nanodiscs

    • Binding assays with known interaction partners

    • Activity assays if enzymatic function is known

  • Biophysical characterization:

    • Size exclusion chromatography to verify monodispersity

    • Dynamic light scattering to assess homogeneity

    • Native mass spectrometry for protein-detergent complexes

These approaches provide complementary information about protein quality and suitability for downstream applications.

How can CbrB contribute to understanding Shigella pathogenesis mechanisms?

Inner membrane proteins like CbrB may play critical roles in bacterial physiology and pathogenesis. Advanced research approaches include:

  • Systems biology analysis:

    • Interactome mapping to identify protein networks

    • Transcriptomics to identify co-regulated genes

    • Metabolomics to detect changes in bacterial metabolism when cbrB is disrupted

  • Host-pathogen interaction studies:

    • Assess impact on adhesion, invasion, and intracellular survival

    • Evaluate host immune recognition of CbrB

    • Determine if CbrB affects bacterial response to host defense mechanisms

  • Structural biology approaches:

    • High-resolution structure determination

    • Molecular dynamics simulations in membrane environment

    • Structure-guided mutagenesis to identify functional domains

These approaches collectively provide insights into whether CbrB contributes to core bacterial functions or specific virulence mechanisms.

What is the potential role of CbrB in Shigella vaccine development?

Shigella vaccine development has traditionally focused on O-antigens and invasion plasmid antigens, with several approaches showing promise in clinical trials . To evaluate CbrB's potential as a vaccine target:

  • Immunogenicity analysis:

    • Assess antibody responses in natural infection

    • Determine conservation across Shigella strains

    • Identify immunodominant epitopes

  • Protective efficacy studies:

    • Immunization-challenge experiments in animal models

    • Measurement of immune correlates of protection

    • Assessment of cross-protection against multiple serotypes

  • Comparative analysis with established vaccine antigens:

    • Side-by-side comparison with O-antigens and Ipa proteins

    • Evaluation in combination with other antigens

    • Assessment of potential for enhancing existing vaccine candidates

The evidence from clinical studies shows that immunity to Shigella is primarily serotype-specific, with antibodies to O-antigens playing a key role in protection . This context is crucial when evaluating novel antigens like CbrB.

ChallengeAdverse clinical outcomesIgA anti-O-antigen ASC
DiarrhoeaDysentery
Challenge no. 112/14 (86%)10/14 (71%)
Challenge no. 211/12 (92%)10/12 (83%)

Table 1: Response to wild-type Shigella flexneri 2a showing clinical outcomes and antibody-secreting cell (ASC) responses .

How can CbrB be used to develop novel diagnostic approaches for Shigella infections?

Development of diagnostics utilizing CbrB would require:

  • Expression analysis across clinical isolates:

    • Verification of consistent expression in diverse strains

    • Assessment of expression levels during infection

    • Comparison with current diagnostic targets

  • Diagnostic platform development:

    • Development of specific antibodies against CbrB

    • Optimization of detection methods (ELISA, lateral flow, etc.)

    • Assessment of sensitivity and specificity using clinical samples

  • Comparative evaluation:

    • Head-to-head comparison with existing diagnostic methods

    • Assessment of advantages in terms of speed, sensitivity, or specificity

    • Cost-benefit analysis for implementation in resource-limited settings

Successful diagnostics would need to distinguish Shigella from closely related enteric bacteria, particularly E. coli, which shares genetic similarity with Shigella .

How do environmental conditions affect CbrB expression and function?

Understanding environmental regulation provides insights into protein function:

  • Transcriptional analysis under varying conditions:

    • Temperature variation (37°C vs. environmental temperatures)

    • pH changes (gastric transit to intestinal environment)

    • Nutrient availability and oxygen tension

    • Host cell contact or intracellular environment

  • Protein-level analysis:

    • Stability under different conditions

    • Post-translational modifications

    • Membrane localization changes

  • Functional impact assessment:

    • Does environmental regulation correlate with pathogenesis stages?

    • Are there condition-specific interaction partners?

    • How do stress responses affect CbrB function?

How can researchers address solubility challenges when working with recombinant CbrB?

Membrane proteins present unique solubility challenges. Methodological solutions include:

  • Detergent optimization:

    • Screen multiple detergent classes (ionic, non-ionic, zwitterionic)

    • Test detergent concentrations above critical micelle concentration

    • Consider detergent mixtures for optimal solubilization

  • Buffer optimization:

    • Vary pH, ionic strength, and buffer composition

    • Test stabilizing additives (glycerol, specific lipids)

    • Evaluate the effect of reducing agents

  • Alternative approaches:

    • Membrane scaffold proteins (nanodiscs)

    • Amphipathic polymers (amphipols, SMALPs)

    • Fusion with solubility-enhancing tags

Systematic screening using analytical techniques like size exclusion chromatography and dynamic light scattering helps identify optimal conditions for maintaining CbrB in solution.

How should researchers interpret contradictory data regarding CbrB function or interactions?

When confronted with contradictory results, a systematic analytical approach includes:

  • Critical evaluation of experimental differences:

    • Expression systems and purification methods

    • Tags and their potential impact on function

    • Experimental conditions (buffer, temperature, etc.)

  • Validation using multiple approaches:

    • Confirm key findings with orthogonal methods

    • Perform control experiments to rule out artifacts

    • Consider strain-specific differences that might affect results

  • Technical considerations:

    • Protein quality and homogeneity assessment

    • Antibody specificity verification

    • Statistical power and appropriate controls

What strategies can overcome difficulties in generating antibodies against CbrB?

Generating antibodies against membrane proteins presents specific challenges:

  • Antigen preparation strategies:

    • Use of synthetic peptides from predicted extracellular domains

    • Purification of full-length protein in detergent micelles

    • Generation of fusion proteins with carrier proteins

  • Immunization approaches:

    • Multiple host species (rabbits, mice, chickens)

    • DNA immunization to express protein in vivo

    • Prime-boost strategies with different preparations

  • Antibody screening and validation:

    • Testing against native and denatured protein

    • Validation in knockout strains

    • Epitope mapping to confirm specificity

These approaches help overcome the challenges of generating antibodies against potentially poorly immunogenic membrane proteins with limited exposed domains.

How can researchers effectively analyze structure-function relationships in CbrB?

Structure-function analysis of membrane proteins requires specialized approaches:

  • Targeted mutagenesis strategies:

    • Alanine scanning of predicted functional domains

    • Conservative vs. non-conservative substitutions

    • Creation of chimeric proteins with related proteins

  • Functional readouts:

    • Bacterial phenotypes in knockout complementation

    • Protein-protein interaction assays

    • Membrane localization analysis

  • Structural analysis of variants:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to detect conformational differences

    • Molecular dynamics simulations to predict effects

These approaches, used iteratively, allow mapping of functional domains and critical residues without requiring high-resolution structures, which remain challenging for membrane proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.