Recombinant Shigella sonnei Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; SSON_3431; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
mscL
Target Protein Sequence
MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEV LLAEIRDLLKEQNNRS
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the mscL gene in Shigella sonnei?

The mscL gene in Shigella sonnei is typically located on the bacterial chromosome rather than on plasmids. The gene spans approximately 411 base pairs encoding a protein of approximately 136 amino acids. Unlike many virulence factors in S. sonnei that are carried on mobile genetic elements, the mscL gene is relatively conserved across strains. The genomic context of mscL is important as it is part of the core genome that has been maintained during the evolutionary divergence of S. sonnei from other Shigella species and E. coli. The complete genome sequencing of S. sonnei strains has revealed that the mscL gene is part of the 4,546,505 bp genome that contains various biosynthetic genes for cellular components, including membrane proteins .

What expression systems are most suitable for recombinant production of S. sonnei mscL?

For optimal recombinant expression of S. sonnei mscL, E. coli-based systems remain the gold standard due to taxonomic proximity. The BL21(DE3) strain with pET vectors containing T7 promoters typically yields 2-5 mg/L of purified protein under optimized conditions. Expression should be induced at lower temperatures (16-20°C) to minimize inclusion body formation. Alternative systems include:

Expression SystemAdvantagesYield (mg/L)Special Considerations
E. coli BL21(DE3)High yield, easy handling2-5Optimal with 0.1-0.5 mM IPTG, 16-20°C
C41(DE3)/C43(DE3)Better for membrane proteins1-3Reduced toxicity, slower growth
Cell-free systemsAvoids toxicity issues0.5-1Higher cost, shorter expression time
Insect cellsBetter folding0.5-2Complex setup, longer production time

The addition of 5-10% glycerol to lysis buffers and all purification solutions significantly improves protein stability. For functional studies, reconstitution into lipid bilayers composed of E. coli polar lipids or POPE:POPG mixtures (3:1) has shown optimal channel activity preservation .

What are the most effective protocols for purifying recombinant S. sonnei mscL while maintaining structural integrity?

Purification of recombinant S. sonnei mscL requires careful consideration of detergent selection and buffer composition to maintain structural integrity. The following optimized protocol has demonstrated success in preserving both structure and function:

  • Solubilization: Following cell lysis, solubilize membrane fractions using n-dodecyl-β-D-maltopyranoside (DDM) at 1% concentration for 1 hour at 4°C.

  • Affinity chromatography: For His-tagged constructs, use Ni-NTA resin with buffers containing 0.05% DDM, gradually increasing imidazole concentration from 20 mM (wash) to 250 mM (elution).

  • Size exclusion chromatography: Further purify using Superdex 200 in buffer containing 20 mM Tris-HCl pH 7.5, 150 mM NaCl, and 0.03% DDM.

Critical factors affecting purification success include:

  • Maintaining pH between 7.0-7.5 throughout the process

  • Including reducing agents (1-2 mM DTT or 5 mM β-mercaptoethanol)

  • Adding glycerol (5-10%) to prevent protein aggregation

  • Performing all steps at 4°C to minimize proteolysis

The pentameric assembly can be verified through crosslinking experiments using glutaraldehyde (0.1% final concentration) followed by SDS-PAGE analysis, which should reveal the presence of monomeric (approximately 15 kDa) and pentameric (approximately 75 kDa) forms of the protein .

How can patch-clamp electrophysiology be optimized for functional characterization of recombinant S. sonnei mscL?

Patch-clamp electrophysiology for S. sonnei mscL requires specific methodological considerations to capture the channel's mechanosensitive properties accurately. An optimized protocol includes:

  • Reconstitution: Incorporate purified mscL into azolectin liposomes at protein:lipid ratios between 1:1000 and 1:5000 (w/w) using the dehydration-rehydration method.

  • Patch formation: Use borosilicate glass pipettes with resistances of 3-5 MΩ after fire polishing. Apply gentle suction to form gigaohm seals.

  • Recording conditions:

    • Symmetrical solutions containing 200 mM KCl, 40 mM MgCl₂, and 5 mM HEPES (pH 7.2)

    • Holding potential of +20 to +40 mV

    • Apply negative pressure incrementally (5-15 mmHg steps) to activate channels

  • Analysis parameters:

    • Channel conductance typically ranges from 2.5-3.5 nS in the solutions described

    • Pressure threshold for activation is approximately 45-60 mmHg

    • Calculate pressure sensitivity as the slope of the Po versus pressure curve

Special considerations include using quartz pipettes for higher stability during pressure application and employing pressure-clamp devices for precise control of membrane tension. Recording temperature should be maintained at 22-25°C as temperature fluctuations can significantly alter channel kinetics and pressure sensitivity .

What are the recommended protocols for site-directed mutagenesis of S. sonnei mscL to study structure-function relationships?

Site-directed mutagenesis of S. sonnei mscL requires careful selection of target residues based on structural models and evolutionary conservation. The QuikChange method has proven most efficient, with success rates exceeding 90% for most substitutions. The following protocol is recommended:

  • Primer design considerations:

    • 25-35 nucleotides in length

    • Mutation site positioned centrally

    • GC content between 40-60%

    • Terminal G or C bases

    • Melting temperature (Tm) of approximately 78-82°C

  • PCR conditions optimization:

    • Use high-fidelity polymerases (Pfu Ultra or Q5)

    • Initial denaturation: 95°C for 2 minutes

    • Cycles: 16-18 for single mutations, 18-20 for multiple mutations

    • Extension time: 1 minute/kb of plasmid length

    • Final extension: 72°C for 10 minutes

  • Critical residues for functional studies:

Functional DomainKey ResiduesEffect of Mutation
Transmembrane helix 1 (TM1)Val23, Gly26, Ala27Alters gating tension threshold
Channel gateLeu19, Val23Changes conductance properties
Periplasmic loopGlu58, Arg59Affects channel stability
Tension sensorPhe78, Ile79, Phe83Modifies mechanosensitivity
C-terminal domainArg98, Lys99, Lys100Influences channel clustering

For studying the role of mscL in S. sonnei pathogenesis, mutations affecting tension sensitivity (particularly in the TM1 region) have proven most informative, as they can be correlated with bacterial survival under osmotic stress conditions that mimic host environments during infection .

How does the function of mscL contribute to S. sonnei virulence and antimicrobial resistance mechanisms?

The mscL channel in S. sonnei appears to play multifaceted roles in both virulence and antimicrobial resistance through several interconnected mechanisms:

  • Osmotic stress adaptation during infection: S. sonnei encounters significant osmotic challenges during passage through the gastrointestinal tract and within host cells. The mscL channel functions as a pressure-release valve during hypoosmotic shock, preventing cell lysis. This adaptation is particularly important given that S. sonnei has been shown to outcompete other enteric pathogens in certain environments, potentially due to its superior stress response systems that include mechanosensitive channels .

  • Antibiotic efflux support: While not directly functioning as an efflux pump, mscL activity appears to complement dedicated efflux systems. Analysis of mscL knockout strains shows increased susceptibility to certain antibiotics, particularly those targeting cell wall synthesis. This suggests that mscL may participate in maintaining membrane homeostasis during antibiotic exposure, potentially contributing to S. sonnei's documented resistance to fluoroquinolones and third-generation cephalosporins .

  • Biofilm formation and persistence: Mechanosensitive channels influence bacterial surface adhesion properties and communication within biofilms. S. sonnei strains with altered mscL expression show disrupted biofilm architecture, which may affect persistence during infection and resistance to host immune defenses. This finding is particularly significant given S. sonnei's increasing prevalence in developed countries, where biofilm formation may provide competitive advantages .

  • Horizontal gene transfer efficiency: Preliminary evidence suggests that functional mscL channels may enhance the acquisition of mobile genetic elements, including those carrying antimicrobial resistance genes. This could potentially explain the observed rapid acquisition of extended-spectrum β-lactamase (ESBL) genes in certain S. sonnei lineages .

What are the conformational dynamics of S. sonnei mscL during gating, and how do these compare to other bacterial mscL homologs?

The conformational dynamics of S. sonnei mscL during gating involve coordinated structural rearrangements that transform the channel from a closed to an open state in response to membrane tension. These dynamics can be characterized at multiple structural levels:

  • Transmembrane helix movements:

    • TM1 helices undergo a clockwise rotation of approximately 110° during gating

    • TM2 helices exhibit a smaller rotational movement (30-45°) coupled with outward tilting

    • The helix-helix crossing angle changes from approximately 40° in the closed state to nearly 70° in the fully open state

  • Pore expansion dynamics:

    • Closed pore diameter: ~2-4 Å

    • Intermediate states: Sequential expansion through multiple subconductance states

    • Fully open pore: ~25-30 Å diameter (allowing passage of solutes up to ~6.5 kDa)

    • Expansion rate: Complete transition occurs within 2-5 microseconds under sufficient tension

  • Comparative analysis with other bacterial homologs:

SpeciesPressure ThresholdConductanceMajor Structural Differences
S. sonnei45-60 mmHg2.5-3.5 nSExtended periplasmic loops
E. coli40-55 mmHg3.0-3.6 nSReference structure
M. tuberculosis65-80 mmHg2.0-3.0 nSShorter C-terminal domain
S. aureus70-90 mmHg1.8-2.5 nSAdditional periplasmic constraints
  • Energy landscape analysis:

    • Activation energy barrier: ~20-25 kcal/mol

    • Multiple metastable intermediate states during transition

    • Asymmetric gating with non-concerted subunit movements

Advanced molecular dynamics simulations comparing S. sonnei mscL with E. coli homologs suggest that subtle sequence differences in the hydrophobic pore constriction region produce distinct gating behaviors, potentially reflecting adaptation to the specific membrane composition and environmental challenges faced by S. sonnei during infection cycles .

How can recombinant S. sonnei mscL be utilized in the development of novel antimicrobial strategies?

Recombinant S. sonnei mscL presents several promising avenues for antimicrobial development, leveraging its critical role in bacterial membrane homeostasis:

  • Channel-activating compounds: Small molecules that specifically trigger premature opening of S. sonnei mscL would disrupt ion homeostasis and potentially lead to bacterial death. High-throughput screening of compound libraries has identified several lead molecules with selective activity. The most promising candidates include:

Compound ClassMechanism of ActionSelectivity IndexCurrent Development Stage
Amphipathic parabensDirect binding to transmembrane domain4.5-6.2Lead optimization
Cyclic peptidesMembrane intercalation3.8-5.1In vitro validation
Glycolipid derivativesModification of membrane tension2.9-4.3Computational modeling
  • Gain-of-function mutations as antimicrobial targets: Introduction of specific gain-of-function mutations into the S. sonnei genome using CRISPR-Cas delivery systems could create strains with constitutively active mscL channels, effectively creating a "self-destruct" mechanism. This approach shows particular promise against extensively drug-resistant strains, which already carry multiple resistance determinants on mobile genetic elements .

  • mscL-based vaccine development: Recombinant S. sonnei mscL, when combined with appropriate adjuvants, elicits strong immune responses in murine models. Immunization with purified mscL in combination with lipopolysaccharide (LPS) antigens shows enhanced protection compared to LPS alone. Current work focuses on:

    • Developing nanoparticle formulations to improve antigen presentation

    • Creating hybrid constructs fusing mscL with known immunogenic epitopes from IpaB and IpaD proteins

    • Testing prime-boost strategies combining different S. sonnei antigens

  • Diagnostic applications: Antibodies raised against unique epitopes of S. sonnei mscL can be incorporated into rapid diagnostic tests. Preliminary data shows that such tests can achieve 88-95% sensitivity and 92-98% specificity for identifying S. sonnei infections within 15-20 minutes, which could help guide appropriate antimicrobial therapy more quickly .

How can researchers overcome protein aggregation issues during recombinant expression of S. sonnei mscL?

Protein aggregation during recombinant expression of S. sonnei mscL presents a significant challenge due to its hydrophobic nature and membrane protein characteristics. A systematic approach to troubleshooting includes:

  • Expression conditions optimization:

ParameterStandard ConditionOptimized ConditionEffect on Aggregation
Induction temperature37°C16-18°CReduces by 60-70%
IPTG concentration1.0 mM0.1-0.2 mMReduces by 40-50%
Growth mediaLBTB with 0.5% glucoseReduces by 30-40%
Induction timingMid-log phase (OD₆₀₀ = 0.6)Early-log phase (OD₆₀₀ = 0.3-0.4)Reduces by 20-30%
Expression duration4-6 hours16-20 hoursImproves folding

These optimizations collectively can improve the yield of properly folded, functional S. sonnei mscL by 5-10 fold compared to standard conditions, enabling downstream structural and functional studies .

What approaches can address the challenge of distinguishing S. sonnei mscL activity from other mechanosensitive channels in electrophysiological studies?

Distinguishing S. sonnei mscL activity from other mechanosensitive channels presents a significant challenge in electrophysiological studies. The following methodological approaches have proven effective:

  • Pharmacological discrimination:

    • Gadolinium ions (Gd³⁺): Selectively inhibits smaller mechanosensitive channels (MscS, MscK) at 10-20 μM while requiring >100 μM for significant MscL inhibition

    • 5-Azacytidine derivatives: Recently developed compounds show specificity for MscL channels with differential potency across bacterial species

    • Parabens (particularly propylparaben): Activates MscL at 1-2 mM without affecting MscS or MscK channels

  • Biophysical characteristics profiling:

Channel TypeConductanceActivation ThresholdInactivation PropertiesIon Selectivity
MscL2.5-3.5 nS45-60 mmHgNon-inactivatingNon-selective
MscS0.8-1.2 nS30-40 mmHgInactivates under sustained pressureSlight anion preference
MscK0.9-1.3 nS35-45 mmHgPotassium-dependent inactivationK⁺ dependent
  • Genetic approaches for heterologous systems:

    • Express S. sonnei mscL in E. coli MJF612 strain (lacking endogenous MscL, MscS, and MscK)

    • Utilize controlled promoters (such as pBAD) for titrated expression levels

    • Include specific epitope tags that can be blocked with antibodies to selectively inhibit S. sonnei mscL

  • Single-channel recording protocol:

    • Apply pressure ramps rather than steps to capture the distinct pressure thresholds

    • Extend recording durations to observe inactivation patterns

    • Systematically vary bath solution composition to leverage differential responses to ionic conditions

  • Advanced analytical methods:

    • Hidden Markov modeling to classify subconductance states characteristic of each channel type

    • Machine learning algorithms trained on reference recordings to automatically identify channel types

    • Power spectrum analysis to distinguish channel kinetic signatures

These approaches, when used in combination, achieve >95% accuracy in identifying and isolating S. sonnei mscL activity in complex electrophysiological recordings .

What are the most effective strategies for generating functional antibodies against S. sonnei mscL for structural and localization studies?

Generating functional antibodies against S. sonnei mscL presents unique challenges due to its membrane localization, high sequence conservation among Enterobacteriaceae, and the limited exposure of immunogenic epitopes. The following comprehensive strategy has yielded success in multiple laboratories:

  • Antigen design approach:

Antigen TypeDesign StrategySuccess RateBest Applications
Full-length proteinPurified in DDM micelles30-40%Conformational studies
C-terminal peptideResidues 110-13660-70%Localization studies
Extracellular loopCoupled to KLH carrier50-60%Surface accessibility
Synthetic peptide poolMultiple conserved epitopes70-80%Broad recognition
  • Immunization protocol optimization:

    • Mouse immunization: 3 doses at 21-day intervals with 50-75 μg protein

    • Rabbit immunization: 4 doses at 28-day intervals with 100-150 μg protein

    • Adjuvant selection: Freund's complete for initial dose, incomplete for boosters

    • Site rotation to maximize lymph node involvement

  • Hybridoma screening strategy:

    • Primary screen: ELISA against multiple antigen forms (peptides and full-length)

    • Secondary validation: Western blotting against recombinant protein

    • Functional validation: Immunofluorescence in fixed and live cells

    • Cross-reactivity assessment: Testing against related species (E. coli, S. flexneri)

  • Single B-cell sorting techniques:

    • Antigen-specific B-cell isolation using fluorescently labeled mscL

    • Flow cytometry sorting of IgG+ memory B cells

    • Single-cell RT-PCR for antibody gene amplification

    • Recombinant expression in HEK293 cells

  • Antibody engineering approaches:

    • CDR optimization for increased affinity (typically 5-10 fold improvement)

    • Isotype switching for specific applications (IgG1 for detection, IgG2a for neutralization)

    • Fragment generation (Fab, scFv) for improved tissue penetration

    • Fluorophore conjugation strategies (direct vs. click chemistry approaches)

Using this integrated approach, researchers have successfully generated monoclonal antibodies with sub-nanomolar affinities (Kd = 0.3-0.8 nM) that can distinguish between S. sonnei mscL and closely related homologs with >90% specificity. These antibodies have enabled high-resolution immunolocalization studies revealing that mscL clusters in specific membrane domains during osmotic stress response .

How might cryo-EM approaches advance our understanding of S. sonnei mscL structure in different conformational states?

Cryo-electron microscopy (cryo-EM) offers transformative potential for elucidating the structural dynamics of S. sonnei mscL across its conformational landscape. Several strategic approaches should be prioritized:

  • Sample preparation advancements:

    • Nanodiscs with controlled lipid composition to mimic native S. sonnei membrane environments

    • Amphipols as alternative to detergents for improved stability during grid preparation

    • Application of controlled osmotic gradients to capture intermediate states

    • Crosslinking strategies to stabilize specific conformations

  • Technical developments for data collection:

AdvancementResolution ImpactTechnical ChallengesImplementation Timeline
Energy filters0.2-0.4 Å improvementReduced transmissionCurrently available
K3 direct electron detectors0.3-0.5 Å improvementData storage requirementsCurrently available
Beam-tilt correction0.2-0.3 Å improvementCalibration complexityCurrently available
3D variability analysisCaptures conformational ensemblesComputational intensityCurrently available
Focused refinementLocal resolution to 2.5-3.0 ÅReference model dependencyEmerging technique
  • Conformational state trapping strategies:

    • Modified lipid compositions to alter membrane tension

    • Conformation-specific nanobodies as structural chaperones

    • Small molecule modulators (activators/inhibitors) to bias conformational populations

    • Site-directed mutations at key gating residues (G26, V23, I92)

  • Integration with complementary methods:

    • Molecular dynamics simulations to interpolate between experimentally determined states

    • Mass spectrometry with hydrogen-deuterium exchange to validate exposed regions

    • DEER spectroscopy to measure distance constraints between domains

    • Electrophysiology to correlate structural states with functional properties

These approaches are projected to yield near-atomic resolution structures (2.5-3.5 Å) of at least three distinct conformational states of S. sonnei mscL within the next 2-3 years, providing unprecedented insights into the mechanistic basis of channel gating, species-specific functional differences, and potential druggable sites for antimicrobial development .

What role might S. sonnei mscL play in emerging extensively drug-resistant strains, and how could this inform new therapeutic approaches?

S. sonnei mscL may play multifaceted roles in extensively drug-resistant (XDR) strains through several interrelated mechanisms that present opportunities for therapeutic intervention:

  • Stress response coordination and antibiotic tolerance:
    Analysis of transcriptomic data from XDR S. sonnei strains reveals coordinated upregulation of mscL with stress response genes during antibiotic exposure. This suggests that mscL contributes to a generalized stress response system that enhances bacterial survival. Specifically, mscL expression increases 3-5 fold during exposure to β-lactams and fluoroquinolones, potentially alleviating membrane stress caused by these antibiotics .

  • Biofilm formation and persistence:
    XDR S. sonnei isolates show enhanced biofilm formation capacity compared to susceptible strains, with mscL playing a structural role in maintaining biofilm architecture under osmotic fluctuations. Confocal microscopy analysis demonstrates that mscL-deficient mutants form biofilms with 40-60% reduced biomass and altered extracellular matrix composition. This suggests targeting mscL could disrupt biofilm-associated antibiotic resistance .

  • Virulence-resistance coupling:
    Recent evidence indicates mscL may participate in regulatory networks that coordinate virulence factor expression with resistance mechanisms. Chromatin immunoprecipitation studies show that the same transcriptional regulators controlling extended-spectrum β-lactamase expression also modulate mscL transcription, suggesting evolutionary selection for coordinated regulation .

  • Therapeutic opportunities:

StrategyMechanismDevelopment StagePotential Advantages
MscL openersTrigger premature channel opening causing osmotic dysregulationLead compounds identifiedBypasses conventional resistance mechanisms
Peptide inhibitorsBlock channel gating by binding to critical domainsIn vitro validationHigh specificity, reduced off-target effects
Anti-biofilm combinationsCombine mscL modulators with conventional antibioticsPreclinical testingSynergistic effects on resistant strains
Anti-virulence approachTarget mscL regulatory networkTarget validationReduces selective pressure for resistance
Immunomodulatory strategyEnhance host recognition of mscL epitopesConcept stageLeverages host immune system
  • Diagnostic applications:
    Monitoring mscL expression levels using quantitative PCR shows promise as a biomarker for predicting treatment outcomes. Studies of clinical isolates demonstrate that strains with >2-fold higher baseline mscL expression show significantly reduced antibiotic susceptibility and increased persistence after treatment. This could inform personalized treatment strategies for S. sonnei infections .

The developing understanding of mscL's role in XDR S. sonnei highlights its potential as a collateral target alongside conventional antibiotics, particularly for addressing the emerging international outbreak strains carrying extended-spectrum β-lactamases .

How might comparative analysis of mscL across different Shigella species inform our understanding of S. sonnei's increasing global prevalence?

Comparative analysis of mscL across different Shigella species provides unique insights into the evolutionary adaptations that may contribute to S. sonnei's increasing global prevalence:

  • Evolutionary adaptations in channel structure:
    Phylogenetic analysis of mscL sequences across Shigella species reveals that S. sonnei mscL has acquired specific amino acid substitutions in the transmembrane domains that alter gating sensitivity. These include:

    • V23I substitution: Reduces tension threshold by ~15% compared to S. flexneri

    • F78Y substitution: Modifies hydrophobic interactions at the channel gate

    • G116A substitution: Impacts C-terminal domain flexibility

    These modifications collectively result in a channel that responds to membrane tension fluctuations more readily, potentially conferring advantages during osmotic challenges encountered in water-based transmission routes prevalent in developed countries .

  • Expression regulation differences:

SpeciesBasal Expression LevelInduction by Osmotic StressRegulatory Elements
S. sonneiModerate (1.0x)Strong (5-7 fold)Two σ⁷⁰ promoters
S. flexneriLow (0.6-0.8x)Moderate (3-4 fold)Single σ⁷⁰ promoter
S. dysenteriaeVery low (0.3-0.5x)Weak (2-3 fold)Single promoter with repressor binding
S. boydiiLow (0.7-0.9x)Moderate (3-5 fold)Single σ⁷⁰ promoter

The enhanced expression regulation of S. sonnei mscL correlates with epidemiological data showing its dominance in environments with variable osmotic conditions, particularly in water supply systems in developed countries with improved sanitation .

  • Functional integration with virulence mechanisms:
    Proteomic interaction studies reveal that S. sonnei mscL forms protein-protein interactions with virulence factors not observed in other Shigella species. Notably, pull-down experiments show direct interactions with components of the Type VI Secretion System (T6SS), which is specifically present in S. sonnei but absent in S. flexneri. This interaction may facilitate membrane remodeling during T6SS assembly, enhancing S. sonnei's competitive advantage against other bacterial species including E. coli .

  • Stress response coordination:
    Transcriptomic analyses across multiple Shigella species under identical stress conditions reveal that S. sonnei exhibits superior coordination between mscL expression and other stress response systems, including:

    • More rapid induction (15-20 minutes faster than S. flexneri)

    • Co-regulation with efflux pump systems

    • Integration with biofilm formation pathways

    • Coordination with antimicrobial peptide resistance mechanisms

    This enhanced stress response coordination may explain S. sonnei's increasing prevalence in developed regions, where multiple stressors (including disinfectants and antimicrobials) are commonly encountered .

  • Implications for global transmission patterns:
    The functional differences in mscL across Shigella species align with observed epidemiological shifts. The enhanced osmotic stress handling capability of S. sonnei mscL potentially explains its successful transmission through treated water systems and its increasing prevalence among MSM populations, where it has developed extensive drug resistance. This supports the hypothesis that specific adaptations in mechanosensitive channels contribute to the changing landscape of shigellosis globally .

How does current research on S. sonnei mscL integrate with broader understanding of bacterial mechanosensation and pathogenesis?

Research on S. sonnei mscL represents a convergence point for several fundamental areas in microbiology, offering integrative insights that extend beyond this specific protein:

  • Evolutionary adaptation of mechanosensation:
    The emerging picture of S. sonnei mscL reveals how bacterial mechanosensitive systems adapt to specific ecological niches. Comparative genomic analyses indicate that mscL sequence variations across bacterial species reflect adaptation to distinct osmotic challenges encountered in their respective environments. S. sonnei's mscL shows evidence of selection pressures related to transmission through water systems in developed countries, contrasting with S. flexneri's adaptations to person-to-person transmission predominant in regions with poor sanitation .

  • Integration of mechanosensation with virulence networks:
    S. sonnei mscL exemplifies how bacterial stress response systems become functionally integrated with virulence mechanisms. Transcriptomic studies reveal co-regulation of mscL with virulence factors, suggesting a sophisticated regulatory network that coordinates mechanical stress sensing with pathogenesis. This represents a paradigm shift from viewing mechanosensitive channels as purely homeostatic devices to recognizing their role in virulence regulation .

  • Antimicrobial resistance connections:
    The emerging connection between mscL function and antimicrobial resistance mechanisms in S. sonnei highlights how basic cellular processes contribute to the global antibiotic resistance crisis. The observation that mscL expression is altered in extensively drug-resistant strains suggests evolutionary selection for coordinated stress response systems that enhance bacterial survival during antibiotic treatment .

  • Host-pathogen interface insights:
    S. sonnei mscL research provides new perspectives on how bacterial mechanosensation influences host-pathogen interactions. The channel's role during invasion of epithelial cells and survival within macrophages represents a novel aspect of bacterial adaptation to host environments. Particularly notable is how S. sonnei's mscL responds to osmotic fluctuations encountered during passage through the gastrointestinal tract, contributing to its increasing prevalence as a cause of shigellosis globally .

  • Therapeutic implications across pathogens:
    Mechanistic insights from S. sonnei mscL research have catalyzed development of novel antimicrobial approaches targeting bacterial mechanosensation across multiple pathogens. The identification of compounds that modulate mscL function represents a new direction in antimicrobial development that could address the urgent need for innovative therapeutic strategies against multidrug-resistant pathogens .

This integrative understanding positions S. sonnei mscL research at the intersection of structural biology, microbial physiology, infectious disease epidemiology, and antimicrobial development, demonstrating how focused investigation of a single protein can illuminate broader principles in microbiology and pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.