Recombinant Shigella sonnei Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Shigella sonnei Lipid A Export ATP-Binding/Permease Protein MsbA

Recombinant Shigella sonnei Lipid A export ATP-binding/permease protein MsbA (msbA) is a bioengineered variant of the native MsbA transporter, expressed in heterologous systems (e.g., E. coli) for structural, functional, and therapeutic studies. MsbA, a member of the ATP-binding cassette (ABC) transporter family, is essential for transporting lipid A and lipopolysaccharides (LPS) across the inner membrane of gram-negative bacteria, including Shigella species . Its role in bacterial membrane biogenesis and pathogenicity makes it a critical target for antimicrobial and vaccine development.

Mechanism of Action

MsbA operates via a trap-and-flip model:

  1. Binding: Lipid A is recognized by MsbA in the cytoplasmic leaflet.

  2. Transport: ATP hydrolysis drives conformational changes, flipping lipid A to the periplasmic leaflet .

  3. Release: Lipid A is transferred to LPS biosynthesis machinery in the periplasm.

Key Findings:

  • MsbA overexpression suppresses lpxL mutants, restoring lipid A export .

  • Temperature-sensitive MsbA mutants (e.g., WD2) block lipid export, causing inner membrane invaginations .

  • Purified MsbA exhibits ATPase activity, with lipid A acting as a potent activator .

Lipid A and LPS Biosynthesis

Lipid A is the endotoxic core of LPS, critical for bacterial membrane integrity and virulence. MsbA ensures proper lipid A acylation and transport, enabling:

  1. LPS Assembly: Lipid A is ligated to core sugars in the periplasm .

  2. Outer Membrane Stability: Asymmetric LPS distribution (lipid A on the outer leaflet) is maintained .

Genetic Modifications in Shigella Strains

Studies on Shigella mutants highlight MsbA’s interdependence with lipid A biosynthesis:

ModificationImpact
ΔmsbB1Reduces lipid A acylation, lowering endotoxicity .
ΔtolREnhances outer membrane vesicle (OMV) production, aiding vaccine development .

Expression Systems

Recombinant MsbA is typically produced in E. coli, with His-tagged variants for purification . While direct data on Shigella sonnei MsbA is limited, homologs from Rhodoferax ferrireducens and Pseudomonas fluorescens demonstrate:

ParameterRhodoferax MsbA (Q21WN9) Pseudomonas MsbA (Q4KJB2)
Length581 aa (full-length)601 aa (full-length)
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0Tris/PBS, 6% trehalose, pH 8.0

Therapeutic and Diagnostic Potential

  1. Vaccine Development:

    • MsbA is a target for disrupting pathogen membrane biogenesis.

    • Polyvalent MEFA proteins (e.g., Shigella MEFA) incorporating MsbA epitopes show cross-protection against multiple Shigella serotypes .

  2. Antibiotic Target:

    • MsbA inhibitors could block lipid A export, destabilizing bacterial membranes .

Limitations in Shigella sonnei Studies

  • Structural Gaps: No X-ray structures of Shigella sonnei MsbA are available; inferences rely on homologs .

  • Functional Assays: In vitro lipid flip-flop assays for MsbA remain underdeveloped .

Emerging Strategies

  1. Multiepitope Vaccines: Incorporating MsbA epitopes into fusion proteins (e.g., MEFA) enhances immunogenicity .

  2. GMMA-Based Vaccines: Genetically modified Shigella strains overproducing outer membrane antigens (e.g., ΔtolR) may include MsbA-related proteins .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
msbA; SSON_0916; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
msbA
Target Protein Sequence
MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDNLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAIDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ
Uniprot No.

Target Background

Function

MsbA is involved in lipopolysaccharide (LPS) biosynthesis. It translocates the lipid A-core from the inner to the outer leaflet of the inner membrane. Transmembrane domains (TMDs) form a pore within the inner membrane, while the ATP-binding domain (NBD) provides the necessary energy for this process.

Database Links
Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MsbA in Shigella sonnei?

MsbA in Shigella sonnei functions as an essential ATP-binding cassette (ABC) transporter that facilitates the export of lipid A and phospholipids across the inner membrane. It serves as a critical flippase that translocates newly synthesized lipid A molecules from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane, which is a crucial step in outer membrane biogenesis . The protein is classified as an ATP-dependent lipid A-core flippase and belongs to a family of transporters closely related to eukaryotic multidrug resistance (MDR) proteins .

The full-length MsbA protein in S. sonnei consists of 582 amino acids and plays an essential role in bacterial viability, as demonstrated by the lethality of msbA knockouts in related organisms like E. coli . This protein's function is particularly important given that Shigella species, including S. sonnei, are significant causes of diarrhea-associated global morbidity and mortality .

What are the optimal expression systems for recombinant Shigella sonnei MsbA protein?

For successful expression of recombinant S. sonnei MsbA, researchers should consider several methodological approaches:

E. coli Expression Systems:
E. coli is the preferred heterologous expression system for S. sonnei MsbA, with BL21(DE3) or C41(DE3) strains being particularly effective for membrane protein expression . These strains offer advantages including:

  • Genetic similarity to the source organism (both being Gram-negative bacteria)

  • Well-established protocols for membrane protein expression

  • Availability of specialized strains designed to handle toxic membrane proteins

Expression Vector Selection:
Vectors incorporating the following elements yield optimal results:

  • N-terminal His-tag for purification (as used in commercial recombinant preparations)

  • Inducible promoters (T7 or arabinose-inducible systems)

  • Fusion tags that can enhance solubility while maintaining function

Expression Conditions:
The following protocol has proven effective:

  • Culture growth at 37°C until OD600 reaches 0.6-0.8

  • Temperature reduction to 18-20°C prior to induction

  • Induction with low concentrations of inducer (0.1-0.5 mM IPTG)

  • Extended expression period (16-20 hours) at the reduced temperature

  • Supplementation with additional glucose or glycerol as carbon sources

This methodology significantly improves the yield of correctly folded and functional protein while minimizing the formation of inclusion bodies that can occur with membrane proteins.

What purification strategies are most effective for recombinant Shigella sonnei MsbA?

Purifying membrane proteins like MsbA requires specialized approaches. A comprehensive purification strategy includes:

Membrane Isolation:

  • Harvest cells by centrifugation (6,000 × g, 15 minutes, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 100 mM NaCl, protease inhibitors

  • Disrupt cells using sonication or mechanical disruption

  • Remove unbroken cells and debris by centrifugation (10,000 × g, 20 minutes)

  • Isolate membranes by ultracentrifugation (100,000 × g, 1 hour, 4°C)

Solubilization and Purification:

  • Solubilize membrane fraction using detergents (n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol at 1-2%)

  • Apply to Ni-NTA resin for His-tag affinity purification

  • Wash extensively with buffer containing low imidazole (20-40 mM)

  • Elute with increasing imidazole gradient (100-500 mM)

  • Further purify by size exclusion chromatography

Buffer Optimization:
For maintaining protein stability and activity during storage:

  • Include 6% trehalose as a stabilizer

  • Maintain pH at 8.0 using Tris-based buffers

  • Consider adding 10-20% glycerol for long-term storage

  • Store aliquoted protein at -80°C to prevent freeze-thaw damage

This methodology yields purified recombinant MsbA protein suitable for functional and structural studies with purity typically exceeding 90% as determined by SDS-PAGE .

How can researchers effectively study MsbA function in lipid A transport?

Investigating MsbA's role in lipid A transport requires specialized experimental approaches:

ATPase Activity Assays:

  • Prepare proteoliposomes containing purified MsbA

  • Measure ATP hydrolysis using standard phosphate release assays

  • Compare basal activity to lipid A-stimulated activity

  • Test with various lipid A chemotypes to determine substrate specificity

Transport Assays:

  • Prepare inside-out membrane vesicles from cells expressing MsbA

  • Load vesicles with fluorescently labeled lipid A analogs

  • Monitor transport kinetics by measuring fluorescence changes

  • Validate with ATP-depleted controls and known inhibitors

Genetic Complementation:
The essential nature of MsbA makes it challenging to study through knockout approaches. Instead, researchers should:

  • Use temperature-sensitive E. coli msbA mutants

  • Complement with S. sonnei msbA

  • Assess restoration of growth at non-permissive temperatures

  • Study the ability to suppress phenotypes of lipid A biosynthesis mutants (e.g., lpxL)

This approach has proven effective in revealing that MsbA overexpression can restore growth of lpxL mutants at 42°C by enabling export of lipopolysaccharides with altered lipid A structures to the outer membrane .

What is the relationship between MsbA and antimicrobial resistance in Shigella sonnei?

The relationship between MsbA and antimicrobial resistance in S. sonnei is multifaceted:

Direct Role in Antibiotic Efflux:
While primarily a lipid A transporter, MsbA's structural similarity to multidrug resistance proteins suggests potential involvement in antibiotic efflux. Researchers should investigate:

  • Susceptibility testing in strains with modulated MsbA expression

  • Direct transport assays with fluorescently labeled antibiotics

  • Competitive binding studies between lipid A and antibiotics

Indirect Contribution to Resistance:
MsbA's role in outer membrane biogenesis contributes to intrinsic resistance:

  • Proper lipid A transport is essential for outer membrane integrity

  • Altered MsbA function may affect permeability barriers

  • Changes in lipid A structure can influence resistance to antimicrobial peptides

Context in Multidrug Resistant Strains:
Many clinical S. sonnei isolates exhibit multidrug resistance patterns. For instance, S. sonnei strain 75/02 demonstrates resistance to ampicillin, streptomycin, tetracycline, chloramphenicol, trimethoprim, and sulfamethoxazole . Researchers should investigate whether MsbA expression levels or sequence variations correlate with resistance profiles in these isolates.

How does MsbA contribute to immune responses against Shigella sonnei?

The potential immunological significance of MsbA should be considered within the broader context of Shigella sonnei immunity:

Lipid A Structure and Immunogenicity:
MsbA-mediated lipid A transport affects the final structure of lipopolysaccharide (LPS) presented on the bacterial surface. Research indicates:

  • LPS-specific serum IgG is associated with protection against shigellosis

  • Different Shigella serotypes induce distinct immune profiles, with S. sonnei inducing robust increases in mucosal antibodies

  • MsbA's role in presenting properly structured LPS may influence both innate and adaptive immune responses

Research Approaches:
To investigate MsbA's immunological relevance, researchers should:

  • Compare immune responses to wild-type S. sonnei versus strains with altered MsbA expression

  • Assess impact on lipid A structure and corresponding TLR4 activation

  • Measure differences in cytokine production and immune cell recruitment

The distinct immune profiles induced by different Shigella serotypes suggest potential differences in pathogen-host interactions that may be influenced by membrane composition and structure .

What is the potential of MsbA as a target for novel antimicrobial strategies?

MsbA represents a promising therapeutic target for several reasons:

Essential Function:
The lethality of msbA knockouts in related organisms highlights its essential nature . Inhibition of MsbA would likely have significant detrimental effects on bacterial viability.

Experimental Approaches for Target Validation:

  • High-throughput screening of chemical libraries using ATPase activity assays

  • Structure-based drug design utilizing MsbA crystal structures

  • Peptidomimetic approaches targeting MsbA-substrate interactions

  • Assessment of synergy between MsbA inhibitors and existing antibiotics

Challenges and Considerations:

  • Selectivity between bacterial and human ABC transporters

  • Membrane permeability of potential inhibitors

  • Potential for resistance development

  • Demonstration of efficacy in animal models of infection

Researchers should employ a multidisciplinary approach combining structural biology, biochemistry, and microbiology to develop and validate MsbA-targeted antimicrobial strategies.

What techniques are most valuable for studying MsbA structure-function relationships?

Several advanced techniques provide critical insights into MsbA structure-function relationships:

Cryo-Electron Microscopy:

  • Prepare MsbA in detergent micelles or nanodiscs

  • Vitrify samples for imaging

  • Collect and process data to obtain high-resolution structures

  • Compare conformational states (e.g., ATP-bound versus nucleotide-free)

Site-Directed Mutagenesis:

  • Target conserved residues in ATP-binding sites and substrate-binding pocket

  • Generate single and multiple amino acid substitutions

  • Assess impact on ATPase activity, substrate binding, and transport

  • Validate functional significance of specific residues

Molecular Dynamics Simulations:

  • Construct membrane-embedded models of S. sonnei MsbA

  • Simulate lipid A binding and translocation events

  • Identify key conformational changes during the transport cycle

  • Predict effects of mutations or inhibitor binding

These complementary approaches can reveal crucial details about MsbA's molecular mechanism and identify potential sites for therapeutic intervention.

How can researchers address the challenges of working with membrane proteins like MsbA?

Working with membrane proteins presents unique challenges requiring specialized approaches:

Structural Stability Optimization:

  • Screen multiple detergents (DDM, LMNG, UDM) for optimal extraction and stability

  • Consider alternative membrane mimetics (nanodiscs, amphipols, SMALPs)

  • Employ thermal stability assays to identify optimal buffer conditions

  • Add stabilizing agents such as trehalose (6%) as used in commercial preparations

Functional Reconstitution:

  • Incorporate purified MsbA into proteoliposomes of defined composition

  • Verify correct orientation using accessibility assays

  • Optimize lipid:protein ratios for maximal activity

  • Include native E. coli or S. sonnei lipids to maintain physiological environment

Expression Optimization:

  • Test multiple induction conditions (temperature, inducer concentration, duration)

  • Consider codon optimization for expression host

  • Explore fusion partners that enhance folding and membrane insertion

  • Implement quality control measures to verify proper folding and membrane localization

These methodological refinements can significantly improve the success rate of structural and functional studies of challenging membrane proteins like MsbA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.