Recombinant Shigella sonnei NADH-quinone oxidoreductase subunit A (nuoA)

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its role in Shigella sonnei?

NADH-quinone oxidoreductase subunit A (nuoA) is a membrane protein component of the NADH dehydrogenase I complex (NDH-1) in Shigella sonnei. This complex functions as the first enzyme in the respiratory electron transport chain, catalyzing the transfer of electrons from NADH to quinones while contributing to the proton motive force for ATP synthesis. In Shigella sonnei, which has emerged as a predominant pathogen in developed countries, nuoA plays a crucial role in energy metabolism . The protein consists of 147 amino acids and contains transmembrane domains that anchor it within the bacterial inner membrane, evident from its amino acid sequence: MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR . The hydrophobic regions in this sequence are characteristic of its membrane-spanning function.

What expression systems are most effective for producing recombinant Shigella sonnei nuoA?

The most commonly employed and effective expression system for recombinant Shigella sonnei nuoA is Escherichia coli . E. coli expression systems are particularly suitable because:

• Genetic relatedness: Since Shigella and E. coli share high genetic similarity (both belonging to Enterobacteriaceae), codon usage patterns are compatible.

• Membrane protein expression: E. coli BL21(DE3) strains and derivatives are engineered to express membrane proteins like nuoA by maintaining reduced expression rates that prevent inclusion body formation.

• Tag compatibility: E. coli systems readily accommodate the His-tag fusion commonly used with nuoA, facilitating purification .

For optimal expression, researchers should consider these methodological parameters:

Additional expression systems that may be considered include cell-free systems for difficult-to-express variants and Pichia pastoris for glycosylation studies, though these present their own technical challenges with membrane proteins.

How should researchers optimize storage conditions for recombinant nuoA stability?

Maintaining the stability of recombinant nuoA requires careful attention to storage conditions due to its membrane protein characteristics. The optimal storage protocol includes:

• Initial lyophilization from a protective buffer containing 6% trehalose, which stabilizes protein structure during freeze-drying .

• Long-term storage at -80°C for lyophilized powder or reconstituted aliquots with 50% glycerol.

• Avoidance of repeated freeze-thaw cycles, which can cause protein denaturation and aggregation .

For working solutions, reconstitution in a Tris/PBS-based buffer (pH 8.0) is recommended, with storage at 4°C for no longer than one week . Researchers should add glycerol (final concentration of 5-50%) to aliquots intended for long-term storage to prevent ice crystal formation that can disrupt protein structure .

For experimental validation of stability, researchers should employ:

• Periodic SDS-PAGE analysis to assess degradation

• Functional assays to confirm activity retention

• Dynamic light scattering to monitor aggregation state

What purification methods yield the highest purity and activity for His-tagged nuoA?

Purification of His-tagged nuoA requires specialized approaches due to its hydrophobic nature as a membrane protein. The most effective purification strategy involves:

• Initial solubilization using a detergent screen to identify optimal conditions:

• Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradients (20-250 mM) to separate His-tagged nuoA from contaminants .

• Size exclusion chromatography as a polishing step to achieve >90% purity and separate monomeric from aggregated protein .

For quality control, SDS-PAGE analysis should confirm purity greater than 90% as specified in the product documentation . Western blotting with anti-His antibodies can verify the identity of the purified protein.

Researchers should note that membrane proteins like nuoA require detergents to remain soluble throughout the purification process, and these detergents may impact downstream applications, particularly activity assays.

How does nuoA contribute to Shigella sonnei pathogenesis and virulence?

While NADH-quinone oxidoreductase subunit A primarily functions in energy metabolism, emerging research suggests potential connections to Shigella sonnei pathogenesis through several mechanisms:

• Energy provision for virulence factor expression: The respiratory chain that includes nuoA generates ATP needed for the production and function of virulence factors, including the type VI secretion system (T6SS) that enables S. sonnei to outcompete other enteric bacteria like Escherichia coli and Shigella flexneri in the gut .

• Adaptation to host environments: The electron transport chain components, including nuoA, may allow S. sonnei to adapt to changing oxygen availability within the host intestinal environment, a critical factor in its ability to establish infection.

• Stress response: Respiratory chain components participate in bacterial responses to oxidative stress encountered during host immune responses.

Recent epidemiological data indicate that S. sonnei has become the predominant Shigella species in developed countries, accounting for up to 80% of infections in North America and Europe . This emergence correlates with improved sanitation reducing cross-immunization from Plesiomonas shigelloides (which shares O-antigen structures with S. sonnei) . Researchers investigating nuoA's role in pathogenesis should consider these epidemiological shifts when designing studies.

What experimental designs are most suitable for studying nuoA interactions with other respiratory chain components?

Investigating the interactions between nuoA and other respiratory chain components requires sophisticated experimental designs that preserve the native membrane environment. Recommended approaches include:

• Co-immunoprecipitation with crosslinking:

  • Chemical crosslinkers with varying spacer lengths (2-12Å) can capture transient interactions

  • MS/MS analysis of crosslinked peptides identifies interaction interfaces

  • Controls should include non-crosslinked samples and irrelevant antibodies

• Blue Native-PAGE coupled with 2D SDS-PAGE:

  • Maintains native protein complexes during first-dimension separation

  • Identifies subunit composition in the second dimension

  • Can detect subcomplexes and assembly intermediates

• FRET-based interaction studies:

  • Fusion of fluorescent proteins to nuoA and potential interaction partners

  • Measurements in membrane vesicles preserve native lipid environment

  • Requires careful controls for expression levels and tag interference

• Cryo-electron microscopy of membrane fractions:

  • Visualizes entire respiratory complexes in near-native states

  • Can be combined with gold-labeled antibodies for specific subunit localization

  • Requires specialized equipment and expertise

Researchers should implement optimal experimental design principles as outlined in current methodological literature, ensuring sufficient replication, randomization, and appropriate controls . The experimental approach should match the specific research question while considering limitations such as potential structural perturbations caused by tags or detection methods.

How can researchers effectively analyze the impact of nuoA mutations on S. sonnei respiratory function?

Analyzing the impact of nuoA mutations on Shigella sonnei respiratory function requires a multi-faceted approach that combines genetic engineering, biochemical assays, and physiological measurements. A comprehensive experimental strategy should include:

• Site-directed mutagenesis approach:

  • Target conserved residues identified through sequence alignment with homologous proteins

  • Evaluate transmembrane domains using hydrophobicity prediction algorithms

  • Create a library of mutations using recombineering or CRISPR-Cas9 techniques

• Functional assays for respiratory activity:

• Structural analysis:

  • Conduct thermal shift assays to assess stability changes

  • Use circular dichroism to detect secondary structure alterations

  • Apply molecular dynamics simulations to predict mutation effects

• In vivo phenotypic characterization:

  • Growth curve analysis under different carbon sources

  • Competitive fitness assays against wild-type strains

  • Measurement of ATP production capacity

When analyzing results, researchers should be mindful of potential compensatory mechanisms that might mask mutation effects, such as upregulation of alternative respiratory enzymes or metabolic rewiring. Statistical analysis should account for biological variability and include multiple biological replicates.

What approaches are most effective for studying the role of nuoA in antibiotic resistance mechanisms of S. sonnei?

The investigation of nuoA's potential role in antibiotic resistance mechanisms of Shigella sonnei requires specialized experimental designs that can distinguish direct from indirect effects. The following approaches are recommended:

• Correlation studies between nuoA expression and antibiotic resistance profiles:

  • Quantitative RT-PCR to measure nuoA expression under antibiotic challenge

  • RNA-seq for genome-wide expression patterns during resistance development

  • Proteomics to confirm translation of transcriptional changes

• Genetic manipulation strategies:

  • Generation of nuoA knockout mutants and assessment of MIC values

  • Controlled overexpression systems to determine dose-dependent effects

  • Complementation studies to confirm phenotype specificity

• Metabolic analysis:

  • Measurement of ATP/ADP ratios in resistant strains

  • Determination of proton motive force changes during antibiotic exposure

  • Metabolomic profiling to identify adaptations in energy metabolism

S. sonnei has shown increasing resistance to multiple antibiotics, including ciprofloxacin and fluoroquinolones, which has contributed to its global spread and the growing burden of antimicrobial resistance . Recent research suggests that alterations in respiratory chain components can contribute to antibiotic tolerance through:

• Modulation of proton motive force affecting antibiotic uptake

• Changes in redox balance influencing antibiotic activation

• Metabolic adaptations that reduce antibiotic target vulnerability

When designing experiments, researchers should consider the multi-factorial nature of antibiotic resistance and implement appropriate controls to distinguish specific nuoA effects from general stress responses.

How can researchers optimize reconstitution protocols for functional studies of nuoA?

Effective reconstitution of nuoA for functional studies requires careful attention to maintaining protein structure and activity. The recommended methodological approach includes:

• Initial preparation:

  • Centrifuge the lyophilized powder briefly before opening to collect material at the bottom of the vial

  • Use deionized sterile water for initial reconstitution to a concentration of 0.1-1.0 mg/mL

  • Allow complete hydration by gentle mixing rather than vigorous vortexing

• Buffer optimization:

  • Tris/PBS-based buffers at pH 8.0 provide optimal stability for His-tagged nuoA

  • Addition of 6% trehalose helps maintain protein structure during storage

  • Consider detergent screening to identify conditions that maintain both solubility and activity

• Activity preservation strategies:

  • Add glycerol to a final concentration of 5-50% for preparations intended for functional studies

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Store working solutions at 4°C and use within one week

For functional studies, researchers should validate activity immediately after reconstitution and periodically during storage using appropriate assays for NADH oxidation activity. The reconstitution protocol may need optimization based on the specific downstream application, particularly when incorporating nuoA into liposomes or nanodiscs for biophysical studies.

What novel analytical techniques are advancing our understanding of nuoA structure-function relationships?

Recent technological advances have expanded the toolkit available for investigating nuoA structure-function relationships. These cutting-edge approaches include:

• Cryo-electron microscopy (cryo-EM) for membrane proteins:

  • Enables visualization of nuoA within the intact respiratory complex

  • Achieves near-atomic resolution without crystallization

  • Captures different conformational states related to function

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

  • Maps solvent accessibility and conformational dynamics

  • Identifies regions involved in protein-protein interactions

  • Requires minimal protein amounts compared to structural techniques

• Single-molecule fluorescence approaches:

  • FRET measurements reveal dynamic structural changes during catalysis

  • Photobleaching analysis determines subunit stoichiometry

  • Super-resolution microscopy visualizes cellular distribution

• Computational methods informed by experimental data:

  • Molecular dynamics simulations predict functional movements

  • Machine learning approaches like those in TabPFN identify structure-function patterns from small datasets

  • Integrative modeling combines diverse experimental constraints

When designing studies using these advanced techniques, researchers should consider optimal experimental design principles as discussed in current methodology literature . This includes careful selection of controls, replication strategies, and appropriate statistical analyses to maximize information gain while minimizing experimental resources.

What emerging research questions about nuoA merit investigation in the context of S. sonnei pathogenesis?

Several compelling research questions about nuoA remain unexplored and could significantly advance our understanding of Shigella sonnei pathogenesis:

• Metabolic adaptation during infection:

  • How does nuoA expression change during different stages of infection?

  • Does respiratory chain remodeling contribute to survival in macrophages?

  • Can metabolic targeting via nuoA disruption reduce virulence?

• Structural biology opportunities:

  • How does the structure of S. sonnei nuoA differ from homologs in non-pathogenic bacteria?

  • What conformational changes occur during electron transfer?

  • Which residues are essential for assembly into the complete NDH-1 complex?

• Host-pathogen interaction studies:

  • Does nuoA-dependent metabolism affect immune recognition?

  • Can host-derived molecules directly interact with or inhibit nuoA?

  • How does respiratory function contribute to intracellular survival?

The growing prevalence of S. sonnei in developed countries (up to 80% of shigellosis cases) and the emergence of antibiotic-resistant strains make these questions particularly relevant. Researchers investigating these questions should implement robust experimental designs that distinguish correlation from causation and employ appropriate controls for genetic manipulation studies.

How can systems biology approaches enhance our understanding of nuoA's role in bacterial physiology?

Systems biology approaches offer powerful frameworks for understanding nuoA within the broader context of bacterial physiology and pathogenesis. Promising methodological strategies include:

• Multi-omics integration:

  • Combining transcriptomics, proteomics, and metabolomics data

  • Constructing genome-scale metabolic models that include respiratory components

  • Identifying regulatory networks controlling nuoA expression

• Flux balance analysis approaches:

  • Quantifying metabolic flux distribution with and without functional nuoA

  • Predicting growth phenotypes under different environmental conditions

  • Identifying synthetic lethal interactions for potential therapeutic targeting

• Network analysis methods:

  • Constructing protein-protein interaction networks centered on respiratory complexes

  • Identifying hub proteins that coordinate respiratory chain assembly

  • Mapping epistatic relationships through double-mutant analyses

• Machine learning applications:

  • Building predictive models of antibiotic resistance based on respiratory chain components

  • Classifying bacterial responses to environmental stressors

  • Identifying patterns in experimental data that might not be apparent through traditional analyses

These systems-level approaches are particularly valuable for understanding complex phenomena like the emergence of S. sonnei as a dominant pathogen in developed countries and could help identify novel intervention strategies targeting energy metabolism.

When designing systems biology studies, researchers should carefully consider good research question formulation principles, ensuring questions are open-ended, researchable, and build upon existing knowledge .