Recombinant Shigella sonnei NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Shigella sonnei?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane-bound component of bacterial respiratory chain Complex I (NADH dehydrogenase I) in Shigella sonnei. It functions as an integral part of the electron transport chain with EC number 1.6.99.5. In Shigella sonnei strain Ss046, nuoK corresponds to Uniprot accession number Q3YZT1 and is encoded by the nuoK gene (SSON_2336) . The protein consists of 100 amino acids and contains multiple hydrophobic regions consistent with its transmembrane topology. The amino acid sequence is: MIPLQHGLILAAILFIL GLTGLVIRRNLLFMLIG LEIMINSALAFVVAGS YWGQTDGQVMYILAISLAAAEASIGLALLLQL HRRRQNLNIDSVSEMRG .

NuoK plays a crucial role in energy metabolism by participating in the electron transfer process and potentially in proton translocation across the membrane, which is essential for energy conservation in bacterial cells.

How does nuoK contribute to bacterial respiratory function?

NuoK functions as part of Complex I (NADH:quinone oxidoreductase), which catalyzes the first step in the respiratory electron transport chain. This process involves:

• Oxidation of NADH to NAD+, which is essential for maintaining cellular redox balance

• Transfer of electrons from NADH to quinones in the membrane

• Generation of proton motive force through proton translocation across the membrane

• Contributing to ATP synthesis via oxidative phosphorylation

While nuoK is a relatively small subunit, it provides structural integrity to the membrane domain of Complex I and likely participates in forming the proton translocation pathway. The protein's hydrophobic nature allows it to span the bacterial inner membrane multiple times, positioning it perfectly to contribute to the proton pumping machinery .

What relationship exists between nuoK and Shigella sonnei pathogenicity?

While nuoK has not been directly characterized as a virulence factor, its function within the respiratory chain has important implications for Shigella sonnei pathogenicity:

• Energy metabolism: As part of the electron transport chain, nuoK contributes to energy generation needed to power various virulence mechanisms.

• Adaptation to host environments: Effective respiratory function supports bacterial adaptation to different oxygen and nutrient conditions encountered during infection.

• Stress response support: Proper energy metabolism underpins bacterial responses to host defense mechanisms.

Shigella sonnei has emerged as a significant global pathogen, particularly in developed countries where it has become the predominant species causing shigellosis . This bacterium employs numerous virulence mechanisms including a type VI secretion system (T6SS) that helps it outcompete other Enterobacteriaceae, production of colicins and mucinases, and expression of proteins that destabilize host intestinal epithelial integrity . The metabolic capabilities supported by proteins like nuoK enable the bacterium to successfully colonize and cause disease in host environments.

What experimental approaches are commonly used for studying recombinant nuoK?

Research involving recombinant nuoK typically employs several methodological approaches:

• Protein expression and purification:

  • Cloning the nuoK gene into expression vectors

  • Expression in bacterial host systems

  • Purification using affinity chromatography

  • Size exclusion chromatography for final purification

• Structural studies:

  • X-ray crystallography to determine three-dimensional structure

  • Cryo-electron microscopy for structural analysis within larger Complex I

  • Circular dichroism spectroscopy to analyze secondary structure

• Functional assays:

  • NADH oxidation assays using spectrophotometric methods

  • Membrane potential measurements

  • Reconstitution into liposomes to study proton translocation

  • Quinone reduction assays

• Interaction studies:

  • Cross-linking experiments with other subunits of Complex I

  • Co-immunoprecipitation assays

  • Blue native PAGE to analyze complex formation

Because nuoK is a membrane protein, special consideration must be given to maintaining proper detergent concentrations during purification and ensuring appropriate membrane-like environments for structural and functional studies .

What are the key structural features of nuoK?

The structural features of nuoK include:

• Transmembrane topology:

  • Multiple hydrophobic regions consistent with transmembrane helices

  • Spans the bacterial inner membrane multiple times

  • Contains charged residues at strategic positions that may participate in proton translocation

• Structural elements:

  • Predominantly alpha-helical secondary structure in the transmembrane regions

  • Small loops connecting transmembrane segments

  • Terminal regions that may interact with neighboring subunits

• Positioning within Complex I:

  • Located in the membrane domain of the complex

  • Forms part of the proton translocation machinery

  • Interacts with other membrane subunits to maintain structural integrity

While high-resolution structural information specifically for Shigella sonnei nuoK is limited, comparative analysis with homologous proteins suggests it adopts a similar fold to other nuoK subunits in bacterial Complex I structures .

How does nuoK participate in electron transfer mechanisms?

NuoK plays a specialized role in the electron transfer mechanisms of Complex I, though it does not directly bind prosthetic groups involved in electron transfer (such as iron-sulfur clusters or FMN). Its contribution involves:

• Structural support for the proton-pumping machinery:

  • Maintains alignment of key residues involved in proton translocation

  • Forms part of the proton channel within the membrane domain

  • Stabilizes conformational states required during catalysis

• Conformational coupling:

  • Participates in conformational changes that couple electron transfer in the hydrophilic domain to proton pumping in the membrane domain

  • Contains residues that may form part of the proton pathway

• Quinone interaction environment:

  • While not directly binding quinones, nuoK's position places it near the quinone binding site

  • May influence the local environment of the quinone binding pocket

  • Could participate in proton delivery to/from the quinone binding site

Studies of similar NADH-quinone oxidoreductases have shown the existence of multiple ubiquinone binding sites (UQI and UQII) that act as intermediates for electron transfer . These binding sites interact with FAD and facilitate the transfer of electrons from NADH to ubiquinone in a process that nuoK helps structurally support.

What methods optimize expression and purification of recombinant nuoK?

Optimizing the expression and purification of membrane proteins like nuoK presents significant challenges. The following methodological approaches have proven effective:

• Expression systems:

  • Bacterial systems: Modified E. coli strains designed specifically for membrane protein expression

  • Cell-free expression systems: Allow direct incorporation into provided lipid environments

  • Fusion partners: MBP, SUMO, or Mistic fusions to enhance solubility and expression

• Expression conditions:

  • Lower induction temperatures (16-20°C)

  • Reduced inducer concentrations

  • Extended expression times (overnight to 48 hours)

  • Specialized media formulations

• Extraction and solubilization:

  • Detergent screening: n-Dodecyl β-D-maltoside (DDM), n-Octyl-β-D-glucopyranoside (OG), Lauryl maltose neopentyl glycol (LMNG)

  • Lipid addition during solubilization

  • Careful optimization of detergent concentration

• Purification strategy:

  • Multi-step affinity purification

  • Size exclusion chromatography as final polishing step

  • Maintaining appropriate detergent concentration throughout

  • Use of lipid additives to maintain protein stability

• Quality assessment:

  • Circular dichroism to confirm secondary structure

  • Thermal stability assays

  • Functional activity measurements

  • Negative stain electron microscopy

For structural studies specifically, additional considerations include reconstitution into nanodiscs or amphipols for cryo-EM studies and screening for conditions that promote crystal formation .

How might nuoK activity relate to antibiotic resistance in Shigella sonnei?

The relationship between nuoK activity and antibiotic resistance in Shigella sonnei is multifaceted:

• Energy dependency of resistance mechanisms:

  • Many antibiotic resistance mechanisms, particularly efflux pumps, require energy

  • As part of the respiratory chain, nuoK contributes to the energy generation needed for these resistance mechanisms

  • Fluoroquinolone and ciprofloxacin resistance, which is increasingly common in S. sonnei, often involves energy-dependent efflux systems

• Metabolic adaptations under antibiotic stress:

  • Bacteria may alter their energy metabolism when exposed to antibiotics

  • Changes in respiratory complex expression or activity could be part of these adaptive responses

  • Alternative electron transport pathways may be utilized under stress conditions

• Redox balance and antibiotic efficacy:

  • Many antibiotics induce oxidative stress

  • NADH:quinone oxidoreductases influence cellular redox balance

  • Changes in nuoK function could affect how cells respond to antibiotic-induced oxidative stress

Ciprofloxacin and fluoroquinolone-resistant S. sonnei has already intensified the global spread and burden of antimicrobial resistance . Understanding the role of metabolic components like nuoK in supporting resistance mechanisms could lead to new therapeutic strategies that target both the resistance machinery and its energetic requirements.

What methodological approaches are valuable for studying nuoK in the context of host-pathogen interactions?

Investigating nuoK's role in host-pathogen interactions requires specialized methodological approaches:

• Genetic manipulation in infection models:

  • Construction of nuoK deletion or point mutation strains

  • Complementation with wild-type or modified nuoK

  • Inducible expression systems to control nuoK levels during infection

  • Reporter fusions to monitor expression in host environments

• Cell culture infection models:

  • Intestinal epithelial cell lines for invasion assays

  • Macrophage infection models to assess intracellular survival

  • Co-culture systems with host immune cells

  • Measurement of bacterial respiratory activity within host cells

• Metabolic profiling during infection:

  • Stable isotope labeling to track metabolic flux

  • Transcriptomic analysis of respiratory genes during infection

  • Comparison of wild-type and nuoK-modified strains in vivo

  • Real-time monitoring of energy metabolism during host cell invasion

• Animal infection models:

  • Mouse models of Shigella infection

  • Tracking bacterial dissemination and persistence

  • In vivo competition assays between wild-type and nuoK-modified strains

  • Response to antibiotic treatment

• Systems biology approaches:

  • Integration of transcriptomic and metabolomic data

  • Network analysis of infection-specific metabolic adaptations

  • Modeling of host-pathogen metabolic interactions

  • Identification of infection-specific vulnerabilities in bacterial metabolism

These approaches enable researchers to understand how respiratory function, supported by nuoK, influences Shigella sonnei's ability to establish infection, survive host defenses, and cause disease.

How does nuoK contribute to Shigella sonnei's adaptation to different host environments?

The nuoK protein, as part of the respiratory chain, contributes significantly to Shigella sonnei's ability to adapt to varying host environments:

• Oxygen availability adaptation:

  • Different host tissues present varying oxygen tensions

  • The respiratory chain containing nuoK helps bacteria adapt to these different conditions

  • Alternative electron transport pathways may be activated in low-oxygen environments

• Energy harvesting in different nutrient conditions:

  • Host environments vary in available carbon sources

  • Respiratory flexibility allows utilization of different electron donors

  • Efficient energy extraction supports survival in nutrient-limited conditions

• Response to host defense mechanisms:

  • Host cells generate reactive oxygen species (ROS) as defense

  • Proper function of nuoK and related proteins helps manage oxidative stress

  • Maintenance of redox balance supports bacterial survival

• Adaptation to pH variations:

  • Different host compartments have varying pH

  • Proton translocation activities involving nuoK affect bacterial pH homeostasis

  • Adaptive changes in respiratory complex expression may occur in different pH environments

• Competition with host microbiota:

  • S. sonnei uses T6SS to outcompete other bacteria

  • Energy from respiratory processes supports competitive mechanisms

  • Metabolic flexibility provides advantage in niche occupation

S. sonnei has shown increasing prevalence globally, replacing S. flexneri in many regions . This shifting pattern may relate to S. sonnei's adaptive capabilities, including its metabolic flexibility in different environments, supported by proteins like nuoK in the respiratory chain.

What functional assays are most informative for studying recombinant nuoK activity?

Functional characterization of recombinant nuoK requires carefully designed assays:

• Reconstitution approaches:

  • Liposome reconstitution with other Complex I subunits

  • Nanodiscs to provide native-like membrane environment

  • Proteoliposomes for proton pumping assays

• NADH oxidation assays:

  • Spectrophotometric tracking of NADH absorption at 340 nm

  • Coupled enzyme assays for enhanced sensitivity

  • Oxygen consumption measurements using respirometry

  • Inhibitor sensitivity profiling (rotenone, piericidin A)

• Proton translocation measurements:

  • pH-sensitive fluorescent dyes (ACMA, pyranine)

  • Ion-selective electrodes for direct proton measurement

  • Membrane potential indicators (DiSC3, JC-1)

  • Time-resolved measurements to capture kinetics

• Quinone reduction assays:

  • Direct measurement of quinone reduction

  • Artificial electron acceptors to isolate specific activities

  • Stopped-flow methods for rapid kinetics

• Conformational change detection:

  • Site-directed spin labeling combined with EPR

  • FRET-based approaches with strategically placed fluorophores

  • Hydrogen-deuterium exchange mass spectrometry

For accurate results, functional assays typically require the presence of other Complex I subunits, as nuoK alone would not show the complete functional activities associated with the intact complex .

What structural biology techniques provide the most insight into nuoK?

Multiple structural biology approaches offer complementary insights into nuoK:

• X-ray crystallography:

  • Challenges: Membrane proteins are difficult to crystallize

  • Approaches: Lipidic cubic phase crystallization, antibody fragment co-crystallization

  • Resolution potential: Can achieve atomic resolution (1.5-3Å)

  • Insights: Precise atomic positions, bound ligands, water molecules

• Cryo-electron microscopy (cryo-EM):

  • Advantages: No crystallization required, captures multiple conformational states

  • Particularly valuable for studying nuoK in the context of the entire Complex I

  • Can visualize lipid interactions in nanodiscs or amphipols

  • Recent advances allow near-atomic resolution

• Nuclear magnetic resonance (NMR):

  • Applications: Dynamics studies, ligand binding, smaller protein domains

  • Limitations: Size constraints make full nuoK structure challenging

  • Can provide information on mobile regions not well-resolved by other methods

• Molecular dynamics simulations:

  • Complement experimental structures with dynamic information

  • Probe proton translocation pathways

  • Model interactions with lipids and other subunits

  • Investigate conformational changes during catalytic cycle

• Hydrogen-deuterium exchange mass spectrometry:

  • Maps solvent accessibility and conformational changes

  • Identifies dynamic regions and interaction interfaces

  • Compatible with detergent-solubilized proteins

The most comprehensive structural understanding comes from integrating multiple techniques, with each method contributing different aspects of nuoK structure and function .

How can genetic manipulation of nuoK inform Shigella sonnei pathogenesis research?

Genetic approaches provide powerful tools for understanding nuoK's role:

• Gene knockout/knockdown strategies:

  • CRISPR-Cas9 genome editing for clean deletions

  • Transposon mutagenesis for random insertions

  • Antisense RNA approaches for partial suppression

  • Inducible systems for temporal control of expression

• Site-directed mutagenesis approaches:

  • Targeting conserved residues predicted to be functionally important

  • Introduction of reporter tags for localization studies

  • Creation of conditional mutants

  • Charge-altering mutations to probe proton translocation pathways

• Phenotypic assessments:

  • Growth curve analysis under different conditions

  • Oxygen consumption measurements

  • Membrane potential determination

  • Antibiotic sensitivity profiling

  • Invasion and intracellular survival in cell culture models

  • Virulence testing in appropriate animal models

• Complementation studies:

  • Rescue with wild-type nuoK

  • Cross-species complementation to assess functional conservation

  • Domain swapping to identify critical regions

  • Controlled expression levels to determine threshold requirements

These approaches allow researchers to connect nuoK function directly to pathogenesis, identifying how respiratory chain components contribute to Shigella sonnei's ability to cause disease and adapt to selective pressures like antibiotic exposure .

What approaches are effective for studying inhibitors of nuoK and Complex I?

Studying inhibitors of Complex I containing nuoK requires specialized approaches:

• Inhibitor screening methodologies:

  • High-throughput screening using NADH oxidation assays

  • Fragment-based screening approaches

  • Structure-based virtual screening

  • Phenotypic screening using growth inhibition

• Mechanism of action studies:

  • Competition assays with known inhibitors

  • Site-directed mutagenesis to identify binding sites

  • Photoaffinity labeling to map binding locations

  • Biophysical methods to measure binding (ITC, SPR, MST)

• Selectivity determination:

  • Comparison with mammalian Complex I inhibition

  • Cross-species activity profiling

  • Testing against isolated bacterial strains

  • Cytotoxicity assessment against host cells

• Efficacy evaluation:

  • Determination of minimum inhibitory concentrations

  • Time-kill assays

  • Post-antibiotic effect measurement

  • Synergy testing with conventional antibiotics

  • Activity in biofilm models

• In vivo assessment:

  • Pharmacokinetic/pharmacodynamic studies

  • Efficacy in animal infection models

  • Toxicity evaluation

  • Resistance development monitoring

Several classes of inhibitors may target Complex I and affect nuoK function, including quinone analogs, phenothiazines, and natural products . These compounds could represent starting points for developing new antimicrobials against increasingly resistant Shigella sonnei strains.

How can systems biology approaches integrate nuoK function into broader understanding of Shigella sonnei pathogenesis?

Systems biology provides frameworks to understand nuoK's role in the broader context:

• Network analysis approaches:

  • Protein-protein interaction networks including nuoK

  • Metabolic network modeling with respiratory chain components

  • Regulatory networks affecting and affected by respiration

  • Signal transduction pathways connected to energy status

• Multi-omics integration:

  • Transcriptomics: Gene expression changes in response to nuoK perturbation

  • Proteomics: Changes in protein abundance and post-translational modifications

  • Metabolomics: Metabolic consequences of altered electron transport

  • Fluxomics: Changes in metabolic flux distributions

• Computational modeling methods:

  • Constraint-based models (e.g., flux balance analysis)

  • Kinetic models of respiratory chain function

  • Agent-based models of host-pathogen interactions

  • Machine learning approaches to identify patterns in multi-omics data

• Experimental validation strategies:

  • Targeted validation of model predictions

  • Testing synthetic lethality predictions

  • Metabolic rescue experiments

  • Engineering of synthetic circuits to probe system properties

• Integration with pathogenesis mechanisms:

  • Connecting energy metabolism to virulence factor expression

  • Modeling adaptation to host environments

  • Understanding resilience mechanisms against host defenses

  • Predicting vulnerabilities for therapeutic targeting

These approaches recognize that nuoK doesn't function in isolation but is part of an integrated network that collectively contributes to Shigella sonnei's ability to cause disease .

What are promising therapeutic applications targeting nuoK or its associated pathways?

Several research avenues show promise for targeting nuoK therapeutically:

• Structure-based drug design:

  • High-resolution structures of nuoK within Complex I

  • Identification of druggable pockets

  • Virtual screening for potential inhibitors

  • Fragment-based approaches to develop novel compounds

• Combination therapy approaches:

  • Identifying synergistic effects between respiratory inhibitors and conventional antibiotics

  • Targeting multiple components of energy metabolism simultaneously

  • Exploiting metabolic vulnerabilities created by nuoK inhibition

• Narrow-spectrum therapeutic development:

  • Exploiting structural differences between bacterial and human complexes

  • Targeting pathogen-specific features of nuoK

  • Developing compounds with selectivity for Shigella over commensal bacteria

• Alternative inhibition strategies:

  • Peptide inhibitors mimicking interaction interfaces

  • Allosteric inhibitors affecting conformational changes

  • Disruption of complex assembly

  • Targeting regulatory mechanisms affecting nuoK expression

• Resistance mitigation approaches:

  • Understanding potential resistance mechanisms

  • Multi-target inhibitors to reduce resistance development

  • Evolutionary constraints analysis to identify conserved targets

The growing global burden of antimicrobial resistance in Shigella sonnei, particularly to fluoroquinolones and ciprofloxacin, underscores the importance of developing novel therapeutic strategies targeting essential components of energy metabolism like nuoK .

How might environmental and epidemiological factors influence nuoK evolution?

Environmental and epidemiological factors shape nuoK evolution in Shigella sonnei:

• Anthropogenic influences:

  • Antibiotic usage patterns driving selection pressure

  • Changing sanitation conditions altering transmission dynamics

  • Global travel facilitating the spread of specific lineages

  • Urbanization creating new ecological niches

• Host-related factors:

  • Immune system pressures selecting for certain variants

  • Dietary changes affecting available nutrient sources

  • Host microbiome competition influencing metabolic requirements

  • Different host populations exerting varying selective pressures

• Ecological considerations:

  • Water quality and environmental persistence

  • Temperature and climate effects on bacterial metabolism

  • Food production and processing environments

  • Animal reservoirs and cross-species transmission

• Competitive microbial dynamics:

  • Competition with other Shigella species and E. coli variants

  • Horizontal gene transfer potentials in different environments

  • Bacteriophage predation selecting for particular genotypes

  • Cross-protection from related environmental bacteria

Studies suggest that improved sanitation has reduced cross-immunization from Plesiomonas shigelliodes (which shares the same O-antigen as S. sonnei), potentially contributing to S. sonnei's increased prevalence . Understanding these factors can help predict future evolutionary trajectories and inform public health strategies.

What are the critical knowledge gaps in nuoK research?

Despite advances in understanding nuoK, several critical knowledge gaps remain:

• Structural understanding:

  • High-resolution structures of Shigella sonnei nuoK are lacking

  • Detailed proton translocation pathways remain incompletely characterized

  • Conformational dynamics during the catalytic cycle need further elucidation

  • Specific lipid interactions that may influence function are poorly understood

• Functional characterization:

  • Precise contribution to proton pumping mechanism remains unclear

  • Regulatory mechanisms controlling expression under different conditions

  • Potential moonlighting functions beyond respiration

  • Interactions with other cellular components outside of Complex I

• Role in pathogenesis:

  • Direct connections between respiratory function and virulence expression

  • Contribution to persistence in host environments

  • Role in antibiotic tolerance and resistance

  • Adaptation to host-specific environments

• Therapeutic potential:

  • Druggability assessment of nuoK and associated regions

  • Specificity determinants for selective targeting

  • Resistance mechanisms that might emerge

  • In vivo efficacy of respiratory chain targeting

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, microbiology, and computational methods. The complex nature of membrane proteins and their integration into larger complexes makes nuoK particularly challenging to study, but its importance in bacterial physiology and potential as a therapeutic target make it worthy of continued investigation.

What integrative approaches might accelerate nuoK research?

Accelerating nuoK research requires integrative approaches that combine multiple disciplines:

• Technological integration:

  • Combining cryo-EM and crystallography data for complete structural models

  • Integrating computational simulations with experimental structures

  • Developing new tools for membrane protein expression and characterization

  • High-throughput screening methods adapted for membrane proteins

• Multi-disciplinary collaborations:

  • Structural biologists working with microbiologists

  • Drug discovery specialists collaborating with infectious disease experts

  • Systems biologists partnering with biochemists

  • Computational scientists working alongside experimental researchers

• Data integration strategies:

  • Creating comprehensive databases of respiratory chain components

  • Developing machine learning approaches to predict structure-function relationships

  • Establishing standardized assays for comparing results across studies

  • Implementing FAIR (Findable, Accessible, Interoperable, Reusable) data principles

• Translational research approaches:

  • Connecting basic research findings to clinical applications

  • Developing model systems that better recapitulate human infection

  • Establishing industry-academic partnerships for drug development

  • Engaging public health stakeholders to address global antimicrobial resistance

The emergence of Shigella sonnei as a globally significant pathogen, particularly with increasing antibiotic resistance, creates urgency for research that can lead to new therapeutic and preventive strategies . Integrative approaches that build on our understanding of fundamental components like nuoK represent a promising path forward.