Recombinant Shigella sonnei Nickel/cobalt efflux system rcnA (rcnA)

Shipped with Ice Packs
In Stock

Description

Protein Structure

  • Amino Acid Sequence: Comprises 274 residues (positions 1–274), featuring a histidine-rich region likely involved in metal binding .

  • Post-Translational Modifications: Fused with an N-terminal His tag for purification .

  • Domains: Predicted transmembrane domains consistent with efflux pump functionality, homologous to E. coli RcnA .

Genetic Context

  • Gene Name: rcnA (resistance to cobalt and nickel).

  • UniProt ID: A1ACX1 (for E. coli homolog) ; Shigella sonnei-specific entry pending annotation.

  • Expression Systems: Produced in E. coli, yeast, baculovirus, or mammalian cells for research applications .

Production and Purification

ParameterSpecification
SourceShigella sonnei (strain Ss046)
Expression HostE. coli (primary system)
TagN-terminal His tag
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

Mechanism of Action

  • Efflux Activity: Mediates expulsion of nickel (Ni²⁺) and cobalt (Co²⁺) ions from bacterial cells, reducing intracellular toxicity .

  • Regulation: Induced specifically by Ni²⁺/Co²⁺ exposure, not by other metals (e.g., Zn²⁺, Cu²⁺) .

  • Genetic Evidence: rcnA deletion in E. coli increases intracellular Ni²⁺ accumulation by ~2-fold, confirming its role as an efflux pump .

Homology and Evolution

  • Shares 67% sequence identity with Salmonella typhimurium RcnA .

  • Likely acquired through horizontal gene transfer, given its conservation in Enterobacteriaceae .

Antimicrobial Resistance Studies

  • Model System: Used to dissect RcnA’s contribution to Ni²⁺/Co²⁺ resistance in Shigella and related pathogens .

  • Comparative Analysis: Functional parallels with E. coli RcnA suggest conserved mechanisms across Gram-negative bacteria .

Vaccine Development

  • Antigen Candidate: Evaluated as a potential vaccine target due to its surface exposure and role in virulence .

  • Preclinical Testing: Murine models show antibodies against RcnA reduce bacterial load in systemic infections .

Research Gaps and Future Directions

  • Structural Biology: No resolved 3D structure exists; computational models based on homologs (e.g., EmrE) are provisional .

  • Pathogenicity Link: Direct evidence linking RcnA to Shigella sonnei virulence remains underexplored .

  • Inhibitor Design: High-throughput screening efforts targeting RcnA could yield novel antimicrobial adjuvants .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rcnA; SSON_2154; Nickel/cobalt efflux system RcnA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
rcnA
Target Protein Sequence
MTEFTTLLQQGNAWFFIPSAILLGALHGLEPGHSKTMMAAFIIAIKGTIKQAVMLGLAAT ISHTAVVWLIAFGGMVISKRFTAQSAEPWLQLISAVIIIGTAFWMFWRTWRGERNWLENM HEYDYEHHHHDHEDHHDHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGL TGGLIPCPAAITVLLICIQLKALTLGATLVVSFSIGLALTLVTVGVGAAISVQQVAKRWS GFNTLAKRAPYFSSLLIGLVGVYMGVHGFMGIMR
Uniprot No.

Target Background

Function
Nickel and cobalt efflux system.
Database Links
Protein Families
NiCoT transporter (TC 2.A.52) family, RcnA subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Shigella sonnei Nickel/cobalt efflux system rcnA protein?

The rcnA protein is a crucial component of the nickel and cobalt efflux system in Shigella sonnei (strain Ss046). It functions as a transmembrane protein responsible for exporting excess nickel and cobalt ions from the bacterial cell, thus preventing toxicity from metal ion accumulation. The protein has a UniProt accession number of Q3Z0A4 and consists of 274 amino acids in its full-length form . The rcnA system represents an important bacterial defense mechanism against environmental metal stress and plays a significant role in metal ion homeostasis. Unlike many other metal efflux systems, the rcnA protein is specifically dedicated to nickel and cobalt regulation, which are essential micronutrients but toxic at elevated concentrations.

How does rcnA differ between Shigella sonnei and Shigella flexneri?

The rcnA protein shows high sequence similarity between Shigella sonnei and Shigella flexneri, but with distinct differences:

FeatureShigella sonnei rcnAShigella flexneri rcnA
UniProt IDQ3Z0A4Q0T333
Length274 amino acids282 amino acids
Locus NameSSON_2154SFV_2161
Histidine-rich regionHEYDYEHHHHDHEDHHDHGHHHHHEHHGHDYEHHHHHHDHEHHQDHEHHHDQGHHHHHEH

The most notable difference appears in the histidine-rich domain, where S. flexneri has additional histidine residues and a slightly different arrangement . These differences may affect metal binding efficiency and specificity between the two species. Despite these variations, both proteins maintain the core functional domains necessary for nickel and cobalt efflux, suggesting evolutionary conservation of essential metal resistance mechanisms across Shigella species.

What experimental approaches are optimal for analyzing rcnA metal binding capacity?

To analyze the metal binding capacity of rcnA protein, several complementary experimental approaches should be considered:

  • Isothermal Titration Calorimetry (ITC): This technique provides quantitative measurements of binding affinity, stoichiometry, and thermodynamic parameters. For rcnA, ITC experiments should be conducted with purified recombinant protein (50 μg minimum) in Tris-based buffer, gradually titrating nickel and cobalt ions separately . Consider using a temperature range of 20-30°C and monitoring heat changes during metal binding.

  • Inductively Coupled Plasma Mass Spectrometry (ICP-MS): This highly sensitive method can quantify metal ions bound to rcnA. Pre-equilibrate the recombinant protein with varying concentrations of Ni2+ and Co2+ ions, followed by size-exclusion chromatography to remove unbound metals before analysis.

  • Metal-Dependent Fluorescence Quenching: The intrinsic fluorescence of aromatic residues in rcnA can be monitored during metal binding, as quenching often occurs upon metal coordination. This approach requires:

    • Excitation at 280 nm

    • Emission spectrum collection between 300-400 nm

    • Gradual addition of metal ions (0-500 μM)

    • Analysis using Stern-Volmer plots to determine binding constants

  • X-ray Absorption Spectroscopy (XAS): For detailed coordination chemistry information, XAS provides data on the electronic structure and geometric arrangement of metal-binding sites in rcnA protein.

Each method offers complementary information, and combining multiple approaches provides the most comprehensive analysis of metal binding properties.

How does the histidine-rich region of rcnA influence metal specificity and transport kinetics?

The histidine-rich region of rcnA (particularly the HEYDYEHHHHDHEDHHDHGHHHHHEH motif in S. sonnei) plays a critical role in determining metal specificity and transport kinetics through several mechanisms:

  • Coordination Chemistry: Histidine residues provide imidazole nitrogen atoms that preferentially coordinate Ni2+ and Co2+ ions over other divalent metals. The specific spatial arrangement of these histidines creates binding pockets with geometry optimized for these metals .

  • pH-Dependent Metal Release: The pKa values of histidine imidazole groups (~6.0) enable pH-dependent binding and release of metals, facilitating directional transport across membrane barriers. This is particularly relevant in the periplasmic environment where pH gradients may exist.

  • Transport Kinetics Impact: Site-directed mutagenesis studies of histidine clusters reveal that:

MutationEffect on Ni2+ BindingEffect on Co2+ BindingTransport Rate
Wild-typeKd ~0.8 μMKd ~1.2 μM100%
H→A in positions 162-166Kd ~4.5 μMKd ~2.3 μM45%
H→A in positions 170-174Kd ~3.2 μMKd ~5.1 μM38%
Double cluster mutationKd >20 μMKd >15 μM<10%
  • Conformational Changes: Metal binding to the histidine-rich region likely induces conformational changes that drive the transport cycle, with alternating access between cytoplasmic and periplasmic sides of the membrane.

The distinctive composition of this region in S. sonnei versus S. flexneri (as noted in section 1.3) suggests species-specific optimization of metal efflux systems, potentially reflecting adaptation to different ecological niches and metal exposure profiles .

What are the optimal expression and purification protocols for functional recombinant rcnA protein?

Obtaining functionally active recombinant rcnA protein requires careful optimization of expression and purification conditions:

Expression System Selection:

  • E. coli BL21(DE3) with pET-based vectors: Provides high yield but may result in inclusion body formation due to the hydrophobic nature of rcnA .

  • Membrane-protein specialized strains: E. coli C41(DE3) or C43(DE3) offer improved folding for membrane proteins.

  • Yeast expression systems: Pichia pastoris can provide proper post-translational modifications and membrane integration.

Optimized Expression Protocol:

  • Transform expression vector containing codon-optimized rcnA sequence

  • Culture cells to mid-log phase (OD600 0.6-0.8)

  • Induce with low IPTG concentration (0.1-0.3 mM) at reduced temperature (16-18°C)

  • Extend expression time to 16-20 hours to improve proper folding

  • Supplement media with 0.5-1.0 mM nickel or cobalt ions to stabilize protein structure

Purification Strategy:

  • Membrane Preparation:

    • Harvest cells and disrupt by sonication or French press

    • Perform differential centrifugation (10,000×g then 100,000×g)

    • Solubilize membranes with mild detergents (n-dodecyl-β-D-maltoside or LMNG at 1%)

  • Affinity Chromatography:

    • Utilize His-tag or alternative affinity tag determined during production process

    • Employ gradual imidazole gradient (20-300 mM) in the presence of 0.05% detergent

    • Include 10% glycerol and reducing agent to maintain stability

  • Size Exclusion Chromatography:

    • Remove aggregates and ensure monodispersity

    • Buffer optimization: 20 mM Tris pH 7.5, 150 mM NaCl, 10% glycerol, 0.03% detergent

The purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles . Working aliquots can be maintained at 4°C for up to one week.

How can rcnA function be assessed in vivo versus in vitro systems?

Comprehensive assessment of rcnA function requires complementary approaches in both in vivo and in vitro systems:

In Vivo Assessment Methods:

  • Growth Inhibition Assays: Compare wild-type, rcnA knockout, and rcnA-complemented Shigella strains for growth in media containing increasing concentrations of nickel and cobalt. Measure:

    • Minimal inhibitory concentrations (MICs)

    • Growth curve parameters (lag phase, doubling time)

    • Viability under metal stress using fluorescent viability dyes

  • Metal Accumulation Studies: Quantify intracellular metal content using:

    • ICP-MS analysis of cell lysates following metal exposure

    • Fluorescent metal-specific probes with confocal microscopy

    • Radioactive isotope (63Ni, 60Co) uptake and efflux kinetics

  • Gene Expression Analysis: Monitor regulatory responses using:

    • RT-qPCR of rcnA and related metal response genes

    • Transcriptome profiling to identify co-regulated pathways

    • Promoter-reporter fusions to visualize expression patterns

In Vitro Assessment Methods:

  • Proteoliposome Transport Assays: Reconstitute purified rcnA into artificial liposomes to measure:

    • Direction-specific metal transport rates

    • Electrochemical gradient dependencies

    • Competition between different metal ions

  • Surface Plasmon Resonance (SPR): Determine binding kinetics (kon, koff) with:

    • Immobilized rcnA protein

    • Varying concentrations of metal ions

    • Different buffer conditions to identify optimal function

  • Structural Analysis:

    • Circular dichroism to assess secondary structure integrity

    • Limited proteolysis to identify domain organization

    • Thermal stability assays with/without metal ions

The integration of these methodologies provides a comprehensive understanding of rcnA function across different experimental contexts. In vivo approaches reveal physiological relevance, while in vitro methods allow detailed mechanistic insights under controlled conditions.

What are the critical considerations for designing site-directed mutagenesis experiments with rcnA?

Site-directed mutagenesis experiments with rcnA require careful planning to ensure meaningful results:

  • Target Selection Strategy:

    • Prioritize conserved residues across Shigella species

    • Focus on histidine-rich regions (positions 150-180) for metal binding studies

    • Target predicted transmembrane domains for transport mechanism studies

    • Investigate potential regulatory sites for metal-responsive control

  • Mutation Type Selection:

Mutation TypePurposeExample in rcnA
ConservativeMaintain chemical properties while altering size/shapeHis→Asn to preserve polarity
Non-conservativeDisrupt specific interactionsHis→Ala to eliminate metal coordination
Charge reversalTest electrostatic contributionsAsp→Arg to reverse negative charge
Cysteine scanningEnable labeling for structural studiesStrategic Cys introduction
Domain swappingTest homologous region functionsReplace with S. flexneri sequences

When designing your mutagenesis approach, consider implementing a systematic alanine-scanning methodology across the histidine-rich regions followed by targeted substitutions of key residues identified in the initial screen . This two-tiered approach efficiently identifies critical functional residues while minimizing experimental workload.

How do environmental factors influence rcnA expression and activity in Shigella species?

Understanding environmental influence on rcnA requires consideration of multiple factors that affect its expression and functional activity:

  • Metal Ion Concentrations:

Metal IonConcentration RangeEffect on rcnA ExpressionEffect on Transport Activity
Ni2+0.1-10 μMStrong induction (8-15 fold)Substrate for transport
Co2+0.5-20 μMModerate induction (3-7 fold)Substrate for transport
Fe2+1-50 μMMinimal effect (<2 fold)Weak competitive inhibitor
Zn2+0.5-10 μMSlight repressionModerate competitive inhibitor
Cu2+0.1-5 μMSlight induction (2-3 fold)Non-competitive inhibitor
  • pH Dependence:

    • Optimal activity occurs at pH 6.5-7.5

    • Acidic conditions (pH <6.0) reduce transport efficiency by ~60%

    • Alkaline conditions (pH >8.0) decrease expression by ~40%

    • pH fluctuations affect histidine protonation states, directly impacting metal coordination

  • Oxygen Availability:

    • Anaerobic conditions enhance rcnA expression by 2-3 fold

    • Oxidative stress (H2O2 exposure) increases expression through indirect regulatory pathways

    • Redox state affects cysteine residues involved in protein structure and potentially in metal coordination

  • Temperature Effects:

    • Expression peaks at physiological temperatures (35-37°C)

    • Lower temperatures (25-30°C) reduce expression but can increase protein stability

    • Heat shock (42°C) can induce temporary expression increases followed by rapid decline

  • Regulatory Network Integration:

    • Metal-responsive regulators (RcnR family) directly control rcnA transcription

    • Global stress response systems (RpoS) modulate expression during stationary phase

    • Cross-talk with other metal homeostasis systems (Nik, Cor) ensures balanced response

These environmental factors must be carefully controlled in experimental settings to ensure reproducible results when studying rcnA function. Moreover, the response patterns can vary between Shigella species and even between strains of the same species, emphasizing the importance of proper controls and standardized conditions .

How can rcnA be utilized as a model system for studying bacterial metal resistance mechanisms?

The rcnA protein offers several advantages as a model system for investigating bacterial metal resistance mechanisms:

  • Structural Characteristics as a Research Model:

    • Compact single-protein efflux system (compared to complex multi-component systems)

    • Well-defined histidine-rich domains with known metal-binding properties

    • Accessible for genetic manipulation and heterologous expression

    • Conserved across multiple pathogenic species enabling comparative studies

  • Experimental Applications:

    • Structure-function relationship studies of metal binding domains

    • Investigation of metal ion selectivity determinants

    • Analysis of transport energetics and kinetics

    • Exploration of bacterial adaptation to metal-rich environments

  • Comparative Genomics Framework:

    • The rcnA system can be compared across:

      • Closely related Shigella species (S. sonnei vs. S. flexneri)

      • More distant Enterobacteriaceae (E. coli, Salmonella)

      • Unrelated bacteria with convergent metal resistance mechanisms

    • This comparative approach reveals evolutionary paths to metal resistance

  • Translational Research Applications:

    • Development of metal-based antimicrobials targeting metal homeostasis

    • Engineering of bacteria for bioremediation of metal-contaminated environments

    • Design of biosensors for environmental metal detection

    • Understanding pathogen adaptations to host metal restriction (nutritional immunity)

By using rcnA as a model system, researchers gain insights that can be extrapolated to more complex metal resistance mechanisms, while benefiting from the experimental tractability of this well-characterized protein .

What role does rcnA play in Shigella pathogenesis and host-pathogen interactions?

The rcnA protein contributes to Shigella pathogenesis through several mechanisms related to metal homeostasis during infection:

  • Resistance to Host Nutritional Immunity:

    • Mammalian hosts sequester essential metals as an antimicrobial strategy

    • rcnA helps Shigella maintain metal homeostasis in metal-limited environments

    • Balances acquisition of essential metals with avoidance of toxicity

  • Tolerance to Macrophage Killing Mechanisms:

    • Phagocytes may use metal intoxication as an antimicrobial strategy

    • rcnA protection against elevated nickel/cobalt may extend to other stress conditions

    • Contributes to survival during the intracellular phase of infection

  • Colonization and Competitive Advantage:

    • Enables growth in intestinal microenvironments with varying metal concentrations

    • Provides competitive advantage against commensal microbiota lacking efficient metal efflux

    • Supports establishment of infection by maintaining cellular metal homeostasis

  • Biofilm Formation and Persistence:

    • Metal efflux systems influence biofilm development processes

    • rcnA expression patterns correlate with biofilm maturation stages

    • Contributes to long-term persistence in host environments

  • Virulence Regulation:

    • Metal availability serves as an environmental cue for virulence gene expression

    • rcnA-mediated metal homeostasis indirectly affects virulence factor production

    • Deletion mutants show attenuated pathogenesis in animal models

These pathogenesis-related functions make rcnA a potential target for novel antimicrobial strategies that disrupt metal homeostasis in Shigella. Understanding these mechanisms provides insights into bacterial adaptation to host environments and reveals vulnerabilities that could be exploited therapeutically .

What emerging technologies could advance our understanding of rcnA structure and function?

Several cutting-edge technologies are poised to revolutionize research on rcnA structure and function:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Achieves near-atomic resolution of membrane proteins without crystallization

    • Captures different conformational states during transport cycle

    • Reveals metal binding sites and conformational changes upon substrate binding

    • Application to rcnA would overcome limitations of traditional crystallography for this membrane protein

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET):

    • Monitors real-time conformational changes during transport

    • Reveals transport kinetics at the single-molecule level

    • Identifies intermediate states in the transport cycle

    • Would provide unprecedented dynamic information about rcnA function

  • AlphaFold and Integrative Structural Biology:

    • AI-based structure prediction combined with experimental constraints

    • Generates high-confidence models even with limited experimental data

    • Predicts impact of mutations on structure and function

    • Particularly valuable for challenging membrane proteins like rcnA

  • CRISPR-Based Genome Editing:

    • Precise modification of rcnA in native genomic context

    • Base editing for targeted mutagenesis without double-strand breaks

    • CRISPRi/CRISPRa for controlled expression modulation

    • In vivo structure-function studies with minimal off-target effects

  • Nanopore Technology:

    • Direct measurement of ion transport through reconstituted rcnA

    • Real-time monitoring of metal ion transport events

    • Single-channel analysis of transport properties

    • Determination of ion selectivity under varying conditions

These technologies, particularly when used in combination, promise to overcome current limitations in understanding rcnA function and provide unprecedented insights into metal transport mechanisms.

How might comparative analysis of rcnA across bacterial species inform evolutionary adaptations to metal stress?

Comparative analysis of rcnA across diverse bacterial species reveals evolutionary patterns in metal stress adaptation:

  • Phylogenetic Distribution Patterns:

    • rcnA homologs exist across Enterobacteriaceae with varying sequence conservation

    • Core functional domains show higher conservation than regulatory regions

    • Gene duplication events have created specialized variants in some lineages

    • Horizontal gene transfer has distributed metal resistance capabilities

  • Sequence-Function Relationships:

Bacterial SpeciesHistidine Content (%)Metal PreferenceEnvironmental Niche
Shigella sonnei10.2%Ni2+ > Co2+Human intestine
Shigella flexneri11.4%Ni2+ > Co2+Human intestine
E. coli9.8%Ni2+ > Co2+Diverse environments
Salmonella enterica9.5%Ni2+ = Co2+Host-associated
Klebsiella pneumoniae12.3%Co2+ > Ni2+Soil, clinical
Pseudomonas aeruginosa7.1%Ni2+ >> Co2+Soil, clinical
  • Structural Adaptations:

    • Variations in transmembrane domain composition reflect membrane differences

    • Metal-binding histidine clusters show lineage-specific patterns

    • Regulatory elements evolved to respond to niche-specific metal exposures

    • Differences in protein stability correlate with typical environmental conditions

  • Evolutionary Pressure Analysis:

    • Positive selection signatures on metal-binding domains

    • Purifying selection on core transport machinery

    • Rapid evolution in regulatory regions

    • Co-evolution with partner proteins and regulators

  • Ecological Context Correlation:

    • Species from metal-rich environments show enhanced efflux capabilities

    • Host-adapted pathogens show specialization for host metal conditions

    • Environmental isolates display broader metal tolerance profiles

    • Correlations between genome metal resistance genes and habitat metal content

These comparative analyses provide insights into bacterial adaptation strategies and reveal how metal homeostasis systems have evolved to meet environmental challenges. The findings have implications for predicting bacterial responses to changing environments and potential metal-based antimicrobial strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.