Recombinant Shigella sonnei p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; SSON_3383; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
aaeA
Target Protein Sequence
MKTLIRKFSRTAITVVLVILAFIAIFNAWVYYTESPWTRDARFSADVVAIAPDVSGLITQ VNVHDNQLVKKGQILFTIDQPRYQKALEEAQADVAYYQVLAQEKRQEAGRRNRLGVQAMS REEIDQANNVLQTVLHQLAKAQATRDLAKLDLERTVIRAPADGWVTNLNVYTGEFITRGS TAVALVKQNSFYVLAYMEETKLEGGRPGYRAEITPLGSNKVLKGTVDSVAAGVTNASSTR DDKGMATIDSNLEWVRLAQRVPVRIRLDNQQENIWPAGTTATVVVTGKQDRDESQDSFFR KMAHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is AaeA and what is its function in Shigella sonnei?

AaeA is a membrane fusion protein that functions as a subunit of the p-hydroxybenzoic acid efflux pump in Shigella sonnei. It works in conjunction with AaeB to form a functional efflux system that exports aromatic carboxylic acids from the bacterial cell. The AaeAB system primarily serves as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism by removing potentially harmful aromatic compounds .

The AaeA protein is encoded by the aaeA gene (formerly known as yhcQ) and is part of an operon that includes aaeX (formerly yhcR) and aaeB (formerly yhcP). The renaming of these genes from yhc to aae nomenclature reflects their recognized role in aromatic carboxylic acid efflux .

How is the expression of aaeA regulated in Shigella sonnei?

The expression of aaeA in Shigella sonnei is primarily regulated by AaeR (formerly yhcS), a LysR-type transcriptional regulator encoded by a divergently transcribed gene upstream of the aaeXAB operon. AaeR functions as a positive regulator of aaeA expression in response to the presence of aromatic carboxylic acid compounds .

Experimental evidence from E. coli (closely related to Shigella) showed that:

  • The addition of p-hydroxybenzoic acid (pHBA) resulted in up to 145-fold increase in expression of the aaeXAB operon

  • This upregulation was almost completely eliminated in aaeR mutant strains

  • Several aromatic carboxylic acids can serve as inducers of expression

To study this regulation experimentally, researchers typically employ:

  • Reporter gene assays (e.g., luciferase fusions)

  • Real-time PCR measurements of transcript levels

  • DNA binding assays to characterize AaeR-promoter interactions

What role does p-hydroxybenzoic acid play in relation to the AaeA efflux pump?

p-Hydroxybenzoic acid (pHBA) serves multiple roles in relation to the AaeA efflux pump:

  • Primary substrate: pHBA is a principal substrate transported by the AaeAB efflux system, as demonstrated by the hypersensitivity of aaeA (yhcQ) mutant strains to pHBA

  • Signaling molecule: pHBA functions as an inducer that interacts with the AaeR regulator to trigger increased expression of the aaeXAB operon

  • Metabolic indicator: As a metabolic intermediate or byproduct, pHBA accumulation signals potential metabolic imbalance, triggering the "relief valve" function of the efflux system

Experimental evidence shows that:

  • Wild-type strains maintain resistance to pHBA

  • aaeA mutants show hypersensitivity to pHBA

  • Expression of both aaeA and aaeB is necessary and sufficient to restore pHBA resistance in mutant strains

This underscores the specialized role of the AaeAB system in managing aromatic carboxylic acid homeostasis within the bacterial cell.

What are the optimal conditions for expressing recombinant Shigella sonnei AaeA?

Optimizing recombinant expression of S. sonnei AaeA requires careful consideration of several parameters:

Expression Systems:

  • E. coli: Most commonly used due to ease of manipulation and genetic similarity to Shigella

  • Yeast: Useful when protein folding is problematic in prokaryotic systems

  • Baculovirus/insect cells: Advantageous for membrane proteins requiring eukaryotic processing

  • Mammalian cells: Provides native-like environment for more complex applications

Vector Design Considerations:

  • Fusion tags: His6, GST, or MBP tags facilitate purification and can enhance solubility

  • Codon optimization: Adapting codons to match preferred usage in the host organism

  • Signal sequences: Inclusion of appropriate targeting signals for membrane proteins

  • Promoter selection: Inducible promoters (e.g., T7) allow controlled expression

Expression Conditions Matrix:

ParameterOptimization RangeNotes
Temperature16-30°CLower temperatures often improve folding of membrane proteins
Inducer concentration0.1-1.0 mM IPTGTitration needed to balance yield vs. toxicity
Media compositionLB, TB, auto-inductionRich media or specialized formulations may increase yield
Induction timingOD600 0.4-0.8Mid-log phase typically optimal
Expression duration4-24 hoursMembrane proteins often benefit from longer, gentler expression

Extraction and Purification:

  • Membrane proteins require specialized detergents (DDM, LDAO, etc.) for solubilization

  • Two-phase extraction may improve purity

  • IMAC, size exclusion, and ion exchange chromatography can be used in series

Success should be verified through Western blotting, mass spectrometry, and functional assays to confirm proper expression of the target protein.

How can researchers verify the functionality of recombinant AaeA?

Verifying the functionality of recombinant AaeA requires multiple complementary approaches:

1. Genetic Complementation Assays:

  • Transform aaeA-deficient Shigella or E. coli strains with the recombinant aaeA

  • Test for restoration of pHBA resistance using growth inhibition assays

  • Measure minimum inhibitory concentrations (MICs) of known substrates

2. In Vitro Transport Assays:

  • Reconstitute purified AaeA and AaeB into proteoliposomes

  • Measure transport of fluorescently labeled or radiolabeled substrates

  • Monitor efflux kinetics under various conditions (pH, temperature, ion gradients)

3. Binding Studies:

  • Isothermal titration calorimetry (ITC) to measure thermodynamic parameters of substrate binding

  • Surface plasmon resonance (SPR) to determine binding kinetics

  • Fluorescence-based assays using substrate analogs with intrinsic fluorescence

4. Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to verify secondary structure

  • Limited proteolysis to confirm proper folding

  • Thermal shift assays to assess stability in different buffer conditions

5. Protein-Protein Interaction Analysis:

  • Co-purification with AaeB to verify complex formation

  • FRET or crosslinking studies to validate native interactions

  • Pull-down assays to identify interaction partners

A functional AaeA protein should demonstrate:

  • Ability to bind known substrates with expected affinity

  • Capacity to restore resistance phenotypes in genetic complementation

  • Evidence of proper folding and stability

  • Formation of appropriate protein-protein interactions

What methodologies are most effective for studying AaeA-substrate interactions?

To effectively study interactions between AaeA and its substrates, researchers should employ multiple complementary approaches:

Biophysical Methods:

  • Isothermal Titration Calorimetry (ITC): Provides complete thermodynamic profile (ΔH, ΔS, ΔG, Kd) of binding events in solution

  • Surface Plasmon Resonance (SPR): Measures real-time binding kinetics (kon, koff)

  • Microscale Thermophoresis (MST): Detects binding through changes in thermophoretic mobility, requiring minimal sample amounts

  • Fluorescence-based techniques: Including intrinsic tryptophan fluorescence, fluorescence anisotropy, or FRET with labeled substrates

Structural Approaches:

  • X-ray crystallography: Provides atomic-resolution structures of AaeA-substrate complexes

  • NMR spectroscopy: Identifies binding sites through chemical shift perturbations

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps regions with altered solvent accessibility upon substrate binding

  • Computational docking and MD simulations: Predicts binding modes and dynamics

Functional Methods:

  • Substrate competition assays: Using known substrates to compete with test compounds

  • Resistance profiling: Testing growth inhibition by various compounds in wild-type versus AaeA-deficient strains

  • Structure-activity relationship (SAR) studies: Systematically testing structural analogs to define binding requirements

From studies on the AaeAB system, we know that only a select subset of aromatic carboxylic acids serves as substrates among hundreds tested . This selectivity provides a framework for understanding substrate recognition.

Data Integration Approach:
Combining data from multiple methods allows researchers to develop a comprehensive model of AaeA-substrate interactions, including:

  • Binding site location and architecture

  • Key residues involved in recognition

  • Thermodynamic and kinetic parameters

  • Structural changes associated with binding

What role does AaeA play in antimicrobial resistance of Shigella sonnei?

While the primary physiological role of AaeA is in aromatic carboxylic acid efflux, its potential contribution to antimicrobial resistance deserves investigation:

Direct Antimicrobial Efflux:

Indirect Contributions to Resistance:

  • Stress response: AaeAB may alleviate metabolic stress during antibiotic exposure

  • Biofilm formation: Efflux systems can influence biofilm development, which enhances antibiotic tolerance

  • Cross-talk with other resistance mechanisms: AaeAB regulation may interact with broader stress responses

Experimental Approaches to Investigate:

  • Susceptibility testing of aaeA mutants against diverse antibiotic classes

  • Transcriptional profiling of aaeA expression during antibiotic exposure

  • Combinatorial testing of AaeA inhibitors with antibiotics

Recent genomic studies reveal that S. sonnei is increasingly acquiring antimicrobial resistance determinants, with several common genotypes associated with ciprofloxacin and azithromycin resistance . The potential role of efflux systems like AaeAB in these resistance patterns warrants further investigation.

How can researchers study the potential role of AaeA in Shigella sonnei virulence?

To investigate whether AaeA contributes to S. sonnei virulence, researchers should employ a multifaceted approach:

Genetic Manipulation Strategies:

  • Gene knockout: Create precise aaeA deletion mutants using CRISPR-Cas9 or allelic exchange

  • Complementation: Reintroduce wild-type or modified aaeA to verify phenotype specificity

  • Reporter fusions: Monitor aaeA expression during infection using fluorescent or luminescent reporters

In Vitro Infection Models:

  • Epithelial cell invasion assays: Quantify invasion efficiency and intracellular replication

  • Macrophage survival studies: Assess persistence within professional phagocytes

  • Trans-epithelial migration: Measure bacterial translocation across polarized monolayers

Advanced Infection Models:

  • Intestinal organoids: 3D cultures that better recapitulate intestinal architecture

  • Mouse model of shigellosis: A newly developed oral infection model for Shigella that could be adapted for S. sonnei virulence studies

  • Host immune response assessment: Cytokine profiling and immune cell recruitment analysis

Mechanistic Investigations:

  • Metabolic profiling: Identify if aromatic compounds relevant to AaeA function accumulate during infection

  • Transcriptomics: Compare gene expression patterns between wild-type and aaeA mutant during infection

  • Stress resistance: Test sensitivity to host-derived antimicrobial compounds

While there is no direct evidence linking AaeA to S. sonnei virulence in the current literature, recent research has revealed multiple virulence mechanisms in S. sonnei, including O-antigen modifications that resist acidification by phagolysosomes , and the presence of type VI secretion systems that allow S. sonnei to outcompete other Enterobacteriaceae .

How can contradictions in experimental data regarding AaeA function be reconciled?

When faced with contradictory data regarding AaeA function, researchers should employ systematic approaches to identify and resolve discrepancies:

Standardization and Methodological Considerations:

  • Protocol standardization: Develop and implement standardized experimental procedures

  • Strain verification: Confirm genetic background and absence of suppressor mutations

  • Growth condition consistency: Control for media composition, growth phase, and environmental factors

Statistical and Analytical Approaches:

  • Structured classification of contradiction patterns: Apply formalized notation (α, β, θ) as described for contradiction assessment in biomedical data

  • Boolean minimization techniques: Reduce complex contradictory dependencies to minimum required Boolean rules

  • Meta-analysis: Systematically integrate results across multiple studies

Data Integration Framework:

  • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data

  • Cross-species comparison: Analyze AaeA function across Shigella species and E. coli

  • Structure-function correlation: Link structural features to functional outcomes

Contradiction Resolution Table:

Contradiction TypeAnalysis ApproachResolution Strategy
Substrate specificityStandardized binding assaysDefine precise experimental conditions
Expression regulationReporter normalizationAccount for growth effects and media composition
Physiological roleSystems biology modelingIntegrate with metabolic networks
Structural featuresMultiple structural methodsCombine complementary techniques

Using such structured approaches to analyze contradictions helps handle the complexity of multidimensional interdependencies within experimental datasets and supports implementation of generalized contradiction assessment frameworks .

What structural modifications can enhance the stability of recombinant AaeA for research applications?

To enhance the stability and functionality of recombinant AaeA for research applications, several rational modification strategies can be employed:

Fusion Tag Strategies:

  • N-terminal fusions: MBP, GST, or SUMO tags can improve solubility while maintaining function

  • C-terminal stabilization: Addition of folded domains that resist degradation

  • Removable tags: TEV or PreScission protease sites for tag removal after purification

Targeted Mutagenesis Approaches:

  • Surface engineering: Replacing surface-exposed hydrophobic residues to reduce aggregation

  • Disulfide bond introduction: Strategic placement of cysteine pairs to form stabilizing disulfide bridges

  • Proline substitutions: Introduction of prolines in loop regions to reduce flexibility

Sequence-Based Optimization:

  • Consensus design: Utilizing sequence alignments of AaeA homologs to identify stabilizing residues

  • Ancestral sequence reconstruction: Recreating more thermostable ancestral sequences

  • Glycosylation site engineering: When using eukaryotic expression systems

Environmental Stabilization:

  • Membrane mimetics: Selection of optimal detergents, lipids, or nanodiscs

  • Buffer optimization: Screening for stabilizing additives and pH conditions

  • Co-expression with partners: Co-expressing AaeB may stabilize the complex

Experimental Validation Matrix:

Modification ApproachStability AssessmentFunctional Validation
Fusion tagsThermal shift assaySubstrate binding assays
Disulfide engineeringLimited proteolysisComplementation tests
Surface modificationSize-exclusion chromatographyTransport assays
Buffer optimizationLong-term storage stabilityBinding kinetics measurements

When implementing these modifications, it's crucial to verify that the enhanced stability doesn't compromise the native function of AaeA. The sequence of S. sonnei AaeA (310 amino acids) provides numerous opportunities for rational design while preserving functional regions .

How does AaeA from Shigella sonnei compare to homologous proteins in other enteric pathogens?

Comparing AaeA from S. sonnei with homologous proteins in other enteric pathogens provides valuable insights into evolutionary conservation, functional specialization, and potential therapeutic targets:

Sequence and Structural Comparisons:

  • Escherichia coli: The E. coli AaeA shows high sequence similarity to S. sonnei AaeA, reflecting their close evolutionary relationship

  • Shigella dysenteriae: S. dysenteriae also possesses an AaeA homolog, suggesting conservation across Shigella species

  • Other Enterobacteriaceae: Comparative analysis reveals varying degrees of conservation in other pathogens

Functional Conservation Analysis:

OrganismAaeA HomologSubstrate SpecificityRegulatory Mechanism
Shigella sonneiAaeAAromatic carboxylic acidsAaeR (LysR-type regulator)
Escherichia coliAaeAAromatic carboxylic acidsAaeR (LysR-type regulator)
Shigella dysenteriaeAaeAPredicted similar profileLikely AaeR-dependent
Other Shigella spp.Variable presenceUnder investigationLikely conserved

Evolutionary Considerations:

  • S. sonnei emerged relatively recently (~350 years ago) and shows limited genomic diversity

  • The AaeAB system likely evolved in the common ancestor of E. coli and Shigella

  • Conservation suggests important physiological functions maintained through evolution

Antimicrobial Resistance Context:

  • The increasing prevalence of antimicrobial resistance in S. sonnei is a global concern

  • S. sonnei is replacing S. flexneri as the dominant Shigella species in many regions

  • Understanding the role of efflux systems across species may reveal patterns in resistance development

Recent genomic studies have developed frameworks for efficient identification of genotypes and resistance determinants from whole genome sequencing data of S. sonnei, facilitating monitoring of resistant clones at both local and global scales . Such approaches could be extended to study the evolution and distribution of efflux pump components across pathogens.

Can AaeA be targeted for therapeutic interventions against Shigella sonnei infections?

Exploring AaeA as a therapeutic target requires assessment of its essentiality, druggability, and potential for resistance development:

Target Validation Considerations:

  • Essentiality assessment: Determine if AaeA is required for growth or virulence in relevant conditions

  • Specificity evaluation: Compare with human proteins to avoid off-target effects

  • Resistance potential: Assess likelihood of resistance development through mutation or bypass

Therapeutic Strategies:

  • Direct inhibition: Small molecules targeting the AaeA protein directly

  • Expression interference: Compounds that prevent AaeA expression by targeting AaeR

  • Complex disruption: Molecules that prevent AaeA-AaeB interaction

  • Substrate competition: Designing non-toxic substrate analogs that competitively inhibit transport

Development Pathway:

  • High-throughput screening: Test compound libraries for AaeA inhibition

  • Structure-based design: Utilize structural data to design rational inhibitors

  • Fragment-based approaches: Build inhibitors from small molecular fragments that bind to AaeA

  • Repurposing existing drugs: Test approved drugs for AaeA-inhibitory activity

Combination Therapy Potential:
AaeA inhibitors might be most effective when combined with:

  • Traditional antibiotics: Enhancing activity by preventing efflux

  • Other anti-virulence compounds: Targeting multiple virulence systems simultaneously

  • Vaccines: Combining with O-SP vaccines that have shown 72% protection against S. sonnei

While AaeA represents a potential novel target, vaccine development remains a promising approach for S. sonnei prevention. Research has shown that conjugate vaccines containing S. sonnei O-specific polysaccharide (O-SP) can provide significant protection, with IgG antibody levels correlating with protective immunity . A recent study demonstrated that O-SPC (O-SP-core) fragments conjugated to carrier proteins induced significantly higher IgG antibody levels in mice than those elicited by O-SP conjugates .

What experimental models are available for testing interventions targeting AaeA?

A comprehensive evaluation of AaeA-targeting interventions requires multiple model systems at increasing levels of complexity:

In Vitro Biochemical Models:

  • Purified protein assays: Testing direct binding of compounds to recombinant AaeA

  • Reconstituted proteoliposomes: Evaluating effects on transport function

  • Bacterial growth inhibition: Assessing impact on whole-cell susceptibility to toxic substrates

Cellular Infection Models:

  • Epithelial cell lines: Testing effects on bacterial invasion and intracellular survival

  • Macrophage infection: Evaluating impact on survival within professional phagocytes

  • Co-culture systems: Assessing competitive advantage against commensal bacteria

Advanced Experimental Models:

  • Intestinal organoids: 3D cultures of human intestinal epithelium

  • Newly developed oral infection mouse model: A specifically designed mouse model has been developed for Shigella vaccine efficacy studies that could be adapted for testing AaeA inhibitors

  • BALB/c mice with specific pretreatment: Streptomycin and iron (FeCl₃) plus desferrioxamine pretreatment enables oral Shigella infection in mice

Model Evaluation Criteria:

Model SystemAdvantagesLimitationsKey Readouts
Biochemical assaysDirect target engagementLacks biological contextBinding affinity, inhibition constants
Bacterial culturesWhole-cell activitySimplified conditionsGrowth inhibition, resistance frequency
Cell infection modelsHost-pathogen interfaceLimited complexityInvasion efficiency, intracellular survival
Mouse infection modelIn vivo efficacySpecies differencesColonization, weight loss, histopathology

The mouse model described in recent literature demonstrates features of human shigellosis including diarrhea, weight loss, bacterial colonization and progressive colitis with epithelial disruption, providing a valuable platform for testing vaccine candidates and potentially AaeA inhibitors . This model has already been successfully used to demonstrate the immunogenicity and protective efficacy of recombinant protein vaccines against multiple Shigella species, including S. sonnei .

What are the key unresolved questions regarding AaeA function in Shigella sonnei?

Despite significant advances in understanding the AaeAB efflux system, several important questions remain unresolved:

Structural Biology Questions:

  • What is the detailed atomic structure of AaeA, alone and in complex with AaeB?

  • How does substrate binding induce conformational changes in the protein?

  • What is the structural basis for substrate selectivity?

Physiological Role Questions:

  • What is the complete spectrum of natural substrates for the AaeAB system in S. sonnei?

  • Does AaeA function change under different infection conditions or microenvironments?

  • How does the AaeAB system interact with other efflux mechanisms in the cell?

Pathogenesis-Related Questions:

  • Does AaeA contribute directly or indirectly to S. sonnei virulence?

  • Is AaeA expression altered during infection compared to laboratory growth?

  • Does the system play a role in survival within specific host niches?

Evolutionary Questions:

  • How has the AaeAB system evolved specifically in S. sonnei compared to other Shigella species?

  • Has the global emergence of S. sonnei been influenced by changes in efflux pump efficiency?

  • Is there evidence for adaptive evolution in AaeA in response to different environments?

Applied Research Questions:

  • Can specific inhibitors of AaeA be developed as research tools or therapeutic leads?

  • Could AaeA serve as a biomarker for specific S. sonnei lineages or phenotypes?

  • Is there potential for engineering AaeA for biotechnological applications?

Addressing these questions will require interdisciplinary approaches combining structural biology, microbial physiology, infection biology, and computational methods. Recent advances in genomic frameworks for S. sonnei and new infection models provide valuable tools for these investigations.

How might systems biology approaches enhance our understanding of AaeA in bacterial physiology?

Systems biology offers powerful frameworks to place AaeA within the broader context of bacterial physiology and host-pathogen interactions:

Multi-omics Integration Approaches:

  • Transcriptomics: RNA-seq analysis of aaeA expression under various conditions and in different genetic backgrounds

  • Proteomics: Global protein expression changes in response to AaeA deletion or overexpression

  • Metabolomics: Identification of metabolites that accumulate in aaeA mutants

  • Fluxomics: Measurement of metabolic flux changes related to aromatic compound metabolism

Network Analysis Methods:

  • Protein-protein interaction networks: Identifying AaeA interaction partners beyond AaeB

  • Regulatory networks: Mapping how AaeR integrates with other transcriptional regulators

  • Metabolic networks: Positioning AaeAB within aromatic compound metabolism pathways

Computational Modeling Approaches:

  • Genome-scale metabolic models: Incorporating AaeAB function into whole-cell metabolic simulations

  • Agent-based infection models: Simulating the role of efflux systems during host-pathogen interactions

  • Evolutionary models: Predicting selective pressures on AaeA function

Data Integration Framework:

Data TypeAnalysis MethodIntegration Approach
TranscriptomicDifferential expressionIdentify condition-specific activation
MetabolomicUntargeted metabolite profilingDiscover novel substrates
StructuralMolecular dynamicsSimulate transport mechanisms
GeneticSynthetic genetic arraysMap genetic interactions

Expected Outcomes:

  • Identification of unexpected connections between AaeA and other cellular processes

  • Discovery of condition-specific roles for the AaeAB system

  • Prediction of emergent properties not obvious from reductionist approaches

Systems biology approaches may reveal how the AaeAB system functions as a "metabolic relief valve" within the broader context of cellular metabolism and stress responses, potentially uncovering new therapeutic vulnerabilities or explaining the increasing prevalence of S. sonnei in both developed and developing countries .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.