Recombinant Shigella sonnei Potassium-transporting ATPase C chain (kdpC)

What is Shigella sonnei Potassium-transporting ATPase C chain (kdpC)?

The kdpC protein is a subunit of the high-affinity ATP-driven K+ transport system (Kdp) in Shigella sonnei. It functions as part of the KdpFABC complex, which forms an active K+ transport system crucial for bacterial osmoregulation and potassium homeostasis. In the recombinant form available for research, the full-length protein (amino acids 1-190) is typically expressed in E. coli with an N-terminal His tag to facilitate purification and detection .

What is the structure and function of kdpC in Shigella sonnei?

The kdpC protein serves as the C chain component of the potassium-transporting ATPase complex. Structurally, it spans 190 amino acids with the sequence beginning with MSGLRPALSTFLFLLLITGGVYPLLTTALGQWWFPWQANGSLIREGDTVRGSALIGQNF . The protein contains transmembrane domains that assist in anchoring the KdpFABC complex in the bacterial membrane. Functionally, kdpC contributes to potassium ion homeostasis, which is critical for bacterial survival under various osmotic conditions and stress responses.

How is recombinant Shigella sonnei kdpC typically produced?

Recombinant S. sonnei kdpC protein is typically produced using E. coli expression systems. The process involves:

• Cloning the kdpC gene sequence into an appropriate expression vector

• Transformation into a suitable E. coli strain

• Induction of protein expression under optimized conditions

• Cell lysis and protein extraction

• Purification using affinity chromatography (utilizing the His-tag)

• Quality assessment via SDS-PAGE to ensure >90% purity

• Lyophilization for stable storage

How can recombinant kdpC protein be used in Shigella pathogenesis research?

Recombinant kdpC can be employed in multiple experimental approaches to study Shigella pathogenesis:

• Protein-protein interaction studies: Using recombinant kdpC to identify binding partners within host cells or bacterial systems

• Functional assays: Measuring potassium transport activity in reconstituted systems

• Structural biology: Crystallization trials for structural determination

• Virulence characterization: Investigating the role of ion transport in bacterial survival during infection

• Immunological studies: Developing antibodies against kdpC for detection or functional blocking

When designing such experiments, researchers should consider combining functional assays with genetic approaches like those used in Tn-seq studies of Shigella to validate findings through multiple methodologies .

What are appropriate experimental controls when working with recombinant kdpC?

When designing experiments with recombinant kdpC, implement these essential controls:

• Negative controls:

  • Empty vector-expressed protein preparations

  • Denatured kdpC protein for functional assays

  • Non-relevant His-tagged proteins to control for tag effects

• Positive controls:

  • Well-characterized potassium transport proteins from related species

  • Native (non-recombinant) kdpC when available

  • Previously validated functional assay standards

• Technical validation:

  • Confirmation of protein identity via Western blotting or mass spectrometry

  • Activity assessment in controlled buffer conditions

  • Stability testing under experimental conditions

These controls help distinguish specific kdpC-related effects from artifacts of the recombinant expression system or experimental procedures .

How does kdpC function compare between different Shigella species and E. coli?

The kdpC protein shows high conservation among Shigella species and their close relative E. coli, reflecting their evolutionary proximity with approximately 70% shared genomic content . Comparative analysis reveals:

While the core function of potassium transport is conserved across these species, slight variations in regulatory mechanisms may contribute to differential expression under host conditions. When studying kdpC function, these similarities make E. coli an appropriate model system, though species-specific regulatory differences should be considered when interpreting results .

What role does kdpC play in Shigella survival during infection?

The kdpC protein, as part of the KdpFABC complex, plays a crucial role in Shigella survival during infection by:

• Osmotic adaptation: Maintaining potassium homeostasis during exposure to changing osmotic conditions in the intestinal environment

• Stress response: Contributing to bacterial adaptation to host defense mechanisms

• Virulence regulation: Potentially influencing expression of virulence factors through ion-dependent signaling pathways

Transposon insertion studies suggest that disruption of potassium transport genes can significantly impact Shigella growth and survival. While not directly examined in the provided studies, the patterns observed in Tn-seq data for membrane transport proteins indicate that ion homeostasis genes like kdpC likely contribute to fitness during infection . Future research combining recombinant protein studies with in vivo infection models would further elucidate the specific roles of kdpC during pathogenesis.

How can structural analysis of recombinant kdpC contribute to antimicrobial development?

Structural characterization of recombinant kdpC can advance antimicrobial development through several approaches:

• Structure-based drug design: Identifying binding pockets specific to kdpC for small molecule inhibitor development

• Epitope mapping: Determining immunogenic regions for vaccine development

• Functional domain analysis: Identifying critical regions for protein-protein interactions within the KdpFABC complex

• Comparative structural biology: Revealing Shigella-specific features distinct from human transporters

What protein purification strategies are most effective for recombinant kdpC?

Purification of recombinant His-tagged kdpC requires specialized approaches due to its membrane protein characteristics:

• Optimized lysis buffers:

  • Use detergent-containing buffers (e.g., 1% DDM or 0.5% LMNG) to solubilize membrane proteins

  • Include protease inhibitors to prevent degradation

  • Maintain physiological pH (7.0-8.0) to preserve structure

• Affinity chromatography conditions:

  • Ni-NTA resin with gradual imidazole elution (20-250 mM)

  • Low-temperature operation (4°C) to minimize degradation

  • Detergent maintained above critical micelle concentration throughout

• Secondary purification:

  • Size exclusion chromatography to separate monomeric from aggregated protein

  • Ion exchange chromatography for removal of contaminants with similar affinity profiles

• Quality assessment:

  • SDS-PAGE to confirm >90% purity

  • Western blotting with anti-His antibodies to verify identity

  • Mass spectrometry for precise molecular weight determination

When handling the lyophilized protein, reconstitution in appropriate buffers containing detergents is essential to maintain proper folding and prevent aggregation.

What functional assays can validate the activity of recombinant kdpC?

Several complementary functional assays can validate recombinant kdpC activity:

• Reconstitution assays:

  • Incorporation into proteoliposomes with other KdpFABC components

  • Measurement of ATP-dependent potassium transport using fluorescent indicators

  • Assessment of complex assembly via co-immunoprecipitation

• Binding studies:

  • Surface plasmon resonance to quantify interactions with other Kdp subunits

  • Isothermal titration calorimetry to determine binding affinities and thermodynamics

  • Cross-linking studies to identify direct protein-protein interaction sites

• Complementation approaches:

  • Expression in kdpC-deficient bacterial strains to assess functional rescue

  • Growth assessment under potassium-limited conditions

  • Membrane potential measurements in complemented strains

These functional assays should be designed with appropriate controls, including catalytically inactive mutants and related transport proteins from E. coli, to establish specificity of the observed activities .

How can aggregation of recombinant kdpC be prevented during experiments?

Membrane proteins like kdpC are prone to aggregation during handling. Implement these strategies to maintain protein solubility:

• Buffer optimization:

  • Screen multiple detergents (DDM, LMNG, CHAPS) at various concentrations

  • Include stabilizing agents (glycerol 5-10%, specific lipids)

  • Maintain physiological ionic strength (150-300 mM NaCl)

• Handling procedures:

  • Avoid freeze-thaw cycles; aliquot and store at -80°C

  • Maintain temperature control during purification and experimental procedures

  • Centrifuge samples before use to remove pre-formed aggregates

• Reconstitution approaches:

  • Use gradual detergent removal techniques (dialysis, Bio-Beads)

  • Incorporate native-like lipid compositions

  • Optimize protein-to-lipid ratios through systematic testing

• Quality controls:

  • Dynamic light scattering to monitor aggregation state

  • Size exclusion chromatography to verify monodispersity

  • Negative-stain electron microscopy to visualize protein particles

Monitoring protein stability throughout experimental procedures is essential, as aggregation can significantly impact functional assay results and lead to false negative outcomes .

What are common pitfalls in interpreting kdpC functional data from in vitro versus in vivo studies?

Researchers should be aware of several critical considerations when comparing in vitro and in vivo kdpC functional data:

• Context-dependent activity:

  • Recombinant kdpC requires association with other KdpFABC components for full activity

  • Isolated protein may lack regulatory interactions present in cellular context

  • Bacterial growth conditions dramatically affect kdp expression and function

• Technical limitations:

  • In vitro systems may not recapitulate the native membrane environment

  • Tn-seq data provides population-level insights but may miss conditional essentiality

  • Growth defects from gene disruption can be context-dependent

• Integration of approaches:

  • Combine biochemical studies with genetic approaches (e.g., Tn-seq, targeted mutations)

  • Validate in vitro findings with cellular assays

  • Consider complementation studies to confirm specificity

• Data interpretation framework:

  • Distinguish between direct effects on transport and indirect effects on bacterial physiology

  • Consider potential polar effects when interpreting genetic disruption studies

  • Evaluate quantitative aspects (kinetics, affinity) alongside qualitative observations

Transposon insertion density patterns seen in Shigella Tn-seq data suggest that studying membrane proteins like kdpC requires careful consideration of growth conditions, as essential roles may only become apparent under specific stress conditions .

How might kdpC be incorporated into Shigella vaccine development strategies?

While current Shigella vaccine development has largely focused on IpaB and other virulence antigens , the conserved nature of kdpC across Shigella species presents intriguing possibilities for vaccine design:

• Epitope identification:

  • Mapping immunogenic regions of kdpC accessible on the bacterial surface

  • Identifying conserved epitopes across Shigella species for broad protection

  • Evaluating epitope immunogenicity through antibody development

• Fusion protein approaches:

  • Creating kdpC-based fusion proteins with known immunogenic antigens

  • Testing similar strategies to the IpaB-GroEL fusion approach that demonstrated 90-95% protection in mouse models

  • Optimizing expression constructs for stable, immunogenic recombinant proteins

• Delivery platforms:

  • Evaluating intranasal delivery systems similar to those used for IpaB-GroEL fusion proteins

  • Developing nanoparticle formulations incorporating kdpC epitopes

  • Testing prime-boost strategies with different delivery systems

• Immune response characterization:

  • Assessing both humoral and cellular immune responses to kdpC-based vaccines

  • Measuring IgG and IgA antibody titers in mucosal and systemic compartments

  • Evaluating protection against lethal challenge with multiple Shigella species

The experience with IpaB-GroEL fusion proteins, which provided 90-95% protection against lethal challenge with multiple Shigella species, offers a promising template for developing kdpC-based vaccine components .

What emerging technologies could advance kdpC structure-function research?

Several cutting-edge technologies hold promise for deeper understanding of kdpC structure and function:

• Advanced structural approaches:

  • Cryo-electron microscopy for high-resolution structure determination of the complete KdpFABC complex

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions and conformational changes

  • Single-molecule FRET to observe real-time conformational dynamics during transport cycles

• Genetic engineering technologies:

  • CRISPR-Cas9 genome editing for precise modification of kdpC in Shigella

  • Deep mutational scanning to comprehensively map functional residues

  • In-cell crosslinking approaches to capture transient protein interactions

• Systems biology integration:

  • Multi-omics approaches connecting kdpC function to global cellular responses

  • Machine learning analysis of Tn-seq data to identify conditional essentiality patterns

  • Network analysis to position kdpC within infection-relevant pathways

• Advanced infection models:

  • Tissue-engineered intestinal models to study kdpC role during infection

  • Humanized mouse models for more relevant in vivo studies

  • Real-time imaging of fluorescently tagged kdpC during infection processes

Combining these approaches could reveal how kdpC and the KdpFABC complex contribute to Shigella pathogenesis and potentially identify new therapeutic strategies targeting potassium transport systems.