Recombinant Shigella sonnei Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)
Description
Molecular Structure and Characteristics
The Shigella sonnei arnE protein consists of 111 amino acids with a specific sequence that reflects its function as a membrane-embedded flippase involved in lipopolysaccharide modification . As a full-length protein, it contains multiple hydrophobic regions consistent with its transmembrane localization.
Physical and Biochemical Properties
The arnE protein has been successfully produced in recombinant form with various tags to facilitate purification and experimental applications. Table 1 summarizes the key physical and biochemical properties of this protein:
| Property | Characteristics |
|---|---|
| Length | 111 amino acids |
| UniProt ID | P0CB31 |
| Expression Source | E. coli |
| Purification Tag | His-tag |
| Form | Lyophilized powder |
| Purity | >90% (by SDS-PAGE) |
| Structural Features | Predominantly alpha-helical, membrane-embedded |
| Model Confidence (pLDDT) | 88.62 (Confident) |
The high purity level (>90%) achieved through recombinant expression systems enables reliable experimental applications and structural studies .
Genetic Context and Expression
The gene encoding arnE in Shigella sonnei provides important insights into its evolutionary history and functional significance within bacterial physiology.
Gene Organization and Nomenclature
In Shigella sonnei strain Ss046, the arnE gene is designated as SSON_2318.1 . The protein is formally named Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE, but is also referred to by alternative names including L-Ara4N-phosphoundecaprenol flippase subunit ArnE and Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE .
Sequence Conservation Across Species
Sequence analysis reveals significant conservation of arnE across related bacterial species within the Enterobacteriaceae family. The sequence from Shigella sonnei shares remarkable similarity with homologs from Escherichia coli strains, as shown in Table 2:
| Species | Representative Amino Acid Sequence | Key Variations |
|---|---|---|
| Shigella sonnei | MIWLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGSTV | Reference sequence |
| Escherichia coli O45:K1 | MIWLTLVFASLLSVAGQLCQKQATCFAAVNKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSLRHWCGVAFIIGGIVILGSTV | Variations at positions 27-30 (AAVN vs. VAIN) and 81-83 (SLR vs. SPR) |
This high degree of conservation suggests the critical functional importance of arnE across these closely related bacterial species .
Functional Role in Bacterial Physiology
The arnE protein plays a pivotal role in the modification of bacterial surface structures, which directly impacts pathogenicity and antibiotic resistance.
Role in Lipopolysaccharide Modification
As a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex, arnE participates in the transport of aminoarabinose-modified lipid carriers across the bacterial membrane . This process is critical for modifying lipopolysaccharide (LPS), particularly its lipid A component, with 4-amino-4-deoxy-L-arabinose moieties.
The modification of lipid A with aminoarabinose alters the charge properties of the bacterial outer membrane, reducing its affinity for cationic antimicrobial peptides and certain antibiotics. This mechanism represents an important strategy for bacterial survival in hostile environments, including those containing antimicrobial compounds .
Contribution to Virulence and Pathogenicity
The unique aspects of Shigella sonnei pathogenicity are increasingly being recognized, with specific virulence factors distinguishing it from other Shigella species. Recent genomic studies have revealed that S. sonnei possesses a genome of approximately 4,546,505 bp, containing numerous genes involved in lipopolysaccharide biosynthesis .
A critical virulence feature of S. sonnei is its distinctive O antigen capsule, which differs structurally from that of other Shigella species like S. flexneri. This capsule significantly impacts pathogenicity by:
-
Resisting acidification by phagolysosomes
-
Enhancing neutrophil cell death
-
Modulating bacterial invasion capabilities
The role of arnE in LPS modification may contribute indirectly to these virulence mechanisms by altering the structural and chemical properties of the bacterial cell surface.
Role in Antimicrobial Resistance
The modification of LPS with aminoarabinose constitutes a well-documented mechanism for resistance to cationic antimicrobial peptides and certain antibiotics. By facilitating this modification, arnE contributes significantly to the antimicrobial resistance profile of Shigella sonnei .
Research indicates that S. sonnei has demonstrated increasing resistance to multiple antibiotics, including ciprofloxacin and fluoroquinolones, posing significant challenges for treatment. The global spread of antibiotic-resistant S. sonnei strains has intensified the burden of antimicrobial resistance worldwide .
Recombinant Production and Applications
The production of recombinant arnE protein facilitates various research applications and potential therapeutic developments.
Expression Systems and Purification
Recombinant Shigella sonnei arnE protein is typically produced in Escherichia coli expression systems, though alternative platforms including yeast, baculovirus, or mammalian cells may also be employed . The protein is commonly fused to tags, such as His-tags, to facilitate purification through affinity chromatography methods .
The expression region generally encompasses the complete protein sequence (amino acids 1-111) to ensure preservation of native structure and function . Purification typically yields protein with greater than 90% purity, as determined by SDS-PAGE analysis .
Research Applications
The availability of recombinant arnE protein enables various research applications crucial for understanding bacterial pathogenesis and developing therapeutic interventions. Table 4 summarizes key applications:
| Application | Description | Relevance |
|---|---|---|
| SDS-PAGE Analysis | Determination of protein purity and molecular weight | Quality control and characterization of recombinant proteins |
| Vaccine Development | Potential antigen for vaccine formulations | Prevention of S. sonnei infections |
| Structural Studies | Investigation of protein conformation and function | Understanding of membrane protein biology |
| Antimicrobial Research | Target for novel antimicrobial strategies | Development of new antibiotics against resistant strains |
| Diagnostic Development | Component in diagnostic assays | Detection of S. sonnei infections |
The application in vaccine development is particularly noteworthy, as targeting proteins involved in virulence mechanisms may provide effective immunization strategies against S. sonnei infections .
Contextual Understanding Within Shigella sonnei Biology
The significance of arnE must be understood within the broader context of Shigella sonnei's emergence as a global pathogen and its unique biological properties.
Emerging Prevalence of Shigella sonnei
Shigella sonnei has emerged as the second most common cause of shigellosis in low- and middle-income countries (LMICs) and has become the leading cause in developed nations . This shift in dominance from S. flexneri to S. sonnei has been attributed to several factors:
-
Improved sanitation reducing cross-immunization from Plesiomonas shigelliodes, which shares the same O-antigen as S. sonnei
-
Competitive advantages conferred by the Type VI Secretion System (T6SS)
-
Ability to outcompete other Enterobacteriaceae species in specific niches
Unique Surface Structures
A distinctive feature of S. sonnei is its high molecular weight, immunogenic group 4 capsule, which displays structural similarity to the LPS O-antigen. Unlike S. flexneri, S. sonnei can assemble O-antigen material on its cell surface even when unable to produce complete LPS with attached O-antigen .
This capsule significantly modulates S. sonnei virulence in complex ways:
-
Uncapsulated mutants show increased invasiveness in vitro
-
Uncapsulated strains produce stronger inflammatory responses in animal models
-
Capsule deficiency reduces resistance to complement-mediated killing
-
Lack of capsule impairs spread from gut to peripheral organs
-
Capsule overexpression decreases invasiveness and inflammation
These findings suggest that the capsule functions as a regulatory mechanism that balances the bacterium's invasive capabilities with its ability to persist within host environments.
Type VI Secretion System
S. sonnei possesses a functional Type VI Secretion System (T6SS) encoded in its chromosome, which provides competitive advantages in specific niches . This secretion system enables S. sonnei to:
-
Predominate in colonization of the host
-
Outcompete E. coli, S. flexneri, and other related species
-
Kill competitors near intestinal epithelial surfaces
These mechanisms collectively contribute to the increasing global prevalence of S. sonnei as a significant enteric pathogen.
Research Perspectives and Future Directions
The study of arnE and related proteins presents several promising avenues for future research and therapeutic development.
Functional Studies
Further investigation of arnE's specific role within the flippase complex and its direct contributions to antibiotic resistance would enhance our understanding of bacterial defense mechanisms. Techniques such as site-directed mutagenesis could identify critical residues for protein function.
Therapeutic Applications
The potential of arnE as a target for novel antimicrobial strategies warrants exploration. Inhibition of the flippase function could sensitize bacteria to existing antibiotics or immune defense mechanisms. Additionally, the recombinant protein's potential as a vaccine component deserves evaluation through immunological studies and animal models.
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Target Background
Q&A
What is the molecular function of the arnE gene in Shigella sonnei?
The arnE gene in S. sonnei likely functions as part of the arnBCADTEF operon involved in lipopolysaccharide (LPS) modification. Based on homology with related enteric bacteria, this gene encodes a subunit of a membrane flippase that facilitates the transport of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across the cytoplasmic membrane. This modification system is significant because it allows bacteria to modify their LPS structure, potentially affecting interactions with host immunity and antimicrobial compounds.
What is the genetic context of arnE in Shigella sonnei?
In S. sonnei, the arnE gene likely resides within the chromosome as part of the arn operon. Unlike the rfb locus that encodes O-antigen in S. sonnei, which is located on the form I invasiveness plasmid , the arn genes are typically chromosomally encoded. The genomic context of arnE is important for understanding its regulation and expression patterns, particularly under conditions that induce antimicrobial resistance.
How does arnE expression relate to Shigella's pathogenicity?
ArnE's role in LPS modification may contribute to S. sonnei's ability to survive host defense mechanisms. The O-antigen structure, which may be indirectly affected by ArnE-mediated modifications, serves as the basis for distinct Shigella serotypes . Such modifications could affect bacterial surface properties, potentially influencing interactions with host cells and immune system components, though direct evidence for arnE's role in S. sonnei pathogenicity requires further research.
How might arnE contribute to antimicrobial resistance mechanisms in Shigella sonnei?
The arnE gene product likely participates in LPS modifications that reduce the negative charge of the bacterial outer membrane, potentially decreasing susceptibility to cationic antimicrobial peptides and certain antibiotics. Recent research on Chilean S. sonnei strains has revealed complex antimicrobial resistance patterns, including resistance to tetracycline, streptomycin, sulfamethoxazole/trimethoprim, and nalidixic acid . While these resistance profiles are primarily attributed to the Shigella Resistance Locus Pathogenicity Island (SRL PAI) and class 1 and 2 integrons , the potential contribution of arnE-mediated LPS modifications represents an important additional layer of investigation.
What experimental approaches are optimal for analyzing arnE function in Shigella sonnei?
To comprehensively analyze arnE function, researchers should employ multiple approaches:
-
Genetic manipulation: Gene knockout, complementation, and site-directed mutagenesis to determine protein function
-
Transcriptional analysis: RNA-seq or qRT-PCR to measure expression under various conditions
-
Recombinant protein studies: Expression and purification for biochemical characterization
-
Antimicrobial susceptibility testing: Comparative analysis between wild-type and arnE-modified strains
-
Structural biology: Crystallography or cryo-EM to determine protein structure
The choice of appropriate S. sonnei strains is crucial, as genomic analyses have revealed significant variation among clinical isolates . When designing gene knockout experiments, researchers should consider the potential polar effects on downstream genes in the arn operon.
How can researchers effectively express and purify recombinant ArnE for structural and functional studies?
Expressing and purifying membrane proteins like ArnE presents significant challenges. The following methodology is recommended:
-
Expression system selection:
-
E. coli C41/C43 strains designed for membrane protein expression
-
Inducible promoters with fine control over expression levels
-
Fusion tags (His6, MBP, or SUMO) to enhance solubility and facilitate purification
-
-
Optimization parameters:
-
Temperature (typically 16-25°C for membrane proteins)
-
Inducer concentration (lower concentrations often yield better folding)
-
Duration of expression (extended periods at lower temperatures)
-
-
Membrane extraction and protein solubilization:
-
Careful selection of detergents (DDM, LDAO, or digitonin)
-
Lipid supplementation to maintain native-like environment
-
Gradient solubilization to identify optimal conditions
-
-
Purification strategy:
-
IMAC (Immobilized Metal Affinity Chromatography) for initial capture
-
Size exclusion chromatography for oligomeric state assessment
-
Functional validation through reconstitution assays
-
What genomic analysis approaches are most effective for studying arnE in clinical Shigella sonnei isolates?
Based on methodologies used for S. sonnei genomic analysis, researchers should consider:
-
Next-generation sequencing using platforms like Illumina MiSeq with the Nextera XT library protocol, as employed for Chilean S. sonnei strains
-
De novo genome assembly using tools such as Shovill with Spades (Kmer range from 31 to 127)
-
SNP identification by mapping trimmed reads to reference genomes like S. sonnei SS046 using Snippy
-
Phylogenetic analysis with FastTree to identify evolutionary relationships
This genomic approach enables comprehensive analysis of arnE in the context of other resistance determinants and can reveal patterns of selection and evolutionary history.
How can researchers assess the impact of arnE on LPS modifications in Shigella sonnei?
To analyze ArnE-mediated LPS modifications, researchers should employ:
-
LPS extraction protocols:
-
Hot phenol-water extraction
-
Modified Westphal method for higher purity
-
TRI Reagent extraction for small-scale analysis
-
-
Analytical techniques:
-
Mass spectrometry (MALDI-TOF MS) for detailed lipid A structure analysis
-
High-performance liquid chromatography (HPLC) for modified components
-
Nuclear magnetic resonance (NMR) for structural confirmation
-
Silver staining of SDS-PAGE gels for LPS profiling
-
-
Comparative analysis:
-
Wild-type vs. arnE knockout strains
-
Strains grown under different environmental conditions
-
Analysis following exposure to antimicrobial agents
-
The data should be analyzed for changes in 4-amino-4-deoxy-L-arabinose incorporation into lipid A, which would directly indicate ArnE functional activity.
What are the challenges in distinguishing arnE-mediated resistance from other resistance mechanisms?
Distinguishing arnE-specific effects presents several challenges:
-
Overlapping resistance mechanisms: S. sonnei strains often carry multiple resistance determinants, including SRL PAI, which confers resistance to ampicillin, streptomycin, chloramphenicol, and tetracycline
-
Co-selection of resistance genes: Class 1 and 2 integrons frequently co-occur with other resistance elements
-
Variable expression: Resistance genes may be differentially expressed under various conditions
To overcome these challenges, researchers should employ isogenic mutants with controlled genetic backgrounds and use complementation studies to confirm phenotypic effects.
How might arnE knowledge contribute to Shigella sonnei vaccine development?
Understanding arnE's role in LPS modification has potential implications for vaccine development:
-
LPS is a key antigen: S. sonnei O-antigen, encoded by the rfb locus on the form I invasiveness plasmid , is a primary target for vaccine development
-
Cross-protection potential: Modified LPS structures may affect cross-protection between strains
-
Live attenuated vaccine considerations: Researchers at the Lanzhou Institute of Biological Products developed hybrid strains expressing both S. flexneri 2a and S. sonnei O-antigens, which provided ~65% protection against both pathogens
-
Vector-based approaches: Some vaccines have used Salmonella Typhi live vaccine strain Ty21a engineered to express S. sonnei O polysaccharide
The impact of arnE on LPS structure could affect vaccine efficacy, as modifications might alter immune recognition of surface antigens. This is particularly relevant for approaches that rely on consistent LPS presentation.
Could arnE be a viable target for novel antimicrobial development against Shigella sonnei?
The arnE gene product represents a potential therapeutic target for several reasons:
-
Role in resistance: If arnE contributes to antimicrobial peptide resistance, inhibiting it might enhance susceptibility
-
Conservation: If highly conserved across strains, it presents a stable target
-
Specificity: As a bacterial protein without human homologs, targeting it could minimize side effects
-
Synergistic potential: Inhibitors might sensitize resistant strains to existing antibiotics
A drug development pipeline targeting ArnE would involve:
-
High-throughput screening for inhibitors
-
Structure-based drug design
-
Peptide mimetics targeting substrate binding sites
-
Validation in diverse clinical isolates
How does arnE expression vary across different Shigella sonnei lineages and geographic distributions?
Analysis of S. sonnei strains from different geographical regions, such as the Chilean strains showing temporal variations in resistance patterns , suggests potential diversity in arnE expression and regulation. Research should focus on:
-
Comparative genomics across global S. sonnei isolates
-
Expression analysis under standardized conditions
-
Regulatory element identification and comparison
-
Correlation with antimicrobial resistance phenotypes
The pulsegroup analysis of Chilean S. sonnei strains revealed distinct clusters with different resistance profiles , suggesting potential variation in arnE and other resistance-associated genes across lineages.
What is the relationship between arnE and the SRL Pathogenicity Island in multidrug-resistant Shigella sonnei?
The Shigella Resistance Locus Pathogenicity Island (SRL PAI) is a significant contributor to antimicrobial resistance in S. sonnei. Among 349 Chilean strains tested, 192 (55%) were SRL-positive, with distribution varying across different time periods . The relationship between arnE and SRL PAI could be explored through:
-
Co-occurrence analysis: Determining if arnE variants correlate with SRL PAI presence
-
Expression studies: Investigating whether SRL PAI affects arnE regulation
-
Functional interaction: Examining if arnE-mediated resistance mechanisms complement SRL PAI-mediated resistance
-
Evolutionary analysis: Assessing if selective pressures on these elements are linked
Understanding this relationship could provide insights into the evolution and spread of antimicrobial resistance in S. sonnei populations.
How does host environment influence arnE expression and function during Shigella sonnei infection?
The expression and function of arnE likely respond to host environmental cues during infection. Research directions should include:
-
In vivo expression analysis using animal infection models
-
Host-mimicking conditions in vitro (pH variation, antimicrobial peptide exposure, nutrient limitation)
-
Single-cell analysis to assess heterogeneity in expression
-
Correlation with infection stage and bacterial localization
These studies would provide crucial insights into the relevance of arnE during actual infection processes and could guide more effective therapeutic interventions.
