Recombinant Shigella sonnei Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Shigella sonnei Probable 4-Amino-4-Deoxy-L-Arabinose-Phosphoundecaprenol Flippase Subunit ArnF (arnF) is a 128-amino-acid transmembrane protein involved in lipid A modification, a critical mechanism for bacterial resistance to polymyxin antibiotics and cationic antimicrobial peptides . Produced via recombinant DNA technology in E. coli, this His-tagged protein (UniProt ID: Q3YZU8) is utilized in structural, functional, and vaccine development studies due to its role in Shigella pathogenicity .

2.1. Primary Sequence

The full-length ArnF protein sequence is:

MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLSVFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIFLPTTKQRY .

3.1. Mechanism of Action

ArnF facilitates the translocation of 4-amino-4-deoxy-L-arabinose (L-Ara4N)-phosphoundecaprenol from the cytoplasmic to the periplasmic leaflet of the inner membrane. This modification of lipid A with L-Ara4N reduces membrane permeability to cationic antimicrobial peptides, enhancing bacterial survival in hostile environments .

3.2. Phenotypic Impact

Gene Knockout EffectOutcome
Polymyxin B resistanceLost in ΔarnF mutants
Lipid A modificationAbsence of L-Ara4N in ΔarnF, despite normal substrate levels
Periplasmic substrate localizationReduced L-Ara4N-phosphoundecaprenol concentration in ΔarnF

4.1. Antibiotic Resistance Studies

ArnF is a key target for understanding polymyxin resistance mechanisms. Its role in lipid A modification is critical for developing strategies to counteract multidrug-resistant Shigella strains, which increasingly dominate in low- and middle-income countries .

5.1. Plasmid Dynamics

Shigella sonnei’s virulence plasmid (pINV) lacks toxin-antitoxin systems like CcdAB and GmvAT, contributing to high plasmid loss rates (~10⁻⁴ per cell generation). This instability complicates vaccine development but provides insights into ArnF’s regulatory networks .

5.2. Horizontal Gene Transfer

ArnF homologs in E. coli (UniProt ID: P76474) share 98% sequence identity, suggesting evolutionary conservation of lipid A modification pathways across Enterobacteriaceae .

Research Limitations and Future Directions

  • Structural Validation: AlphaFold predictions require experimental validation via cryo-EM or X-ray crystallography .

  • Functional Redundancy: Overlapping roles with ArnE in flippase activity necessitate dual-knockout studies .

  • Antimicrobial Synergy: Combining ArnF inhibitors with polymyxins could enhance efficacy against resistant strains .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchasing method and location. Please contact your local distributors for specific delivery information.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
arnF; SSON_2319; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
arnF
Target Protein Sequence
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF LPTTKQRY
Uniprot No.

Target Background

Function
This protein functions in the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic side to the periplasmic side.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of the arnF flippase subunit in Shigella sonnei?

The arnF subunit in Shigella sonnei functions as part of a flippase complex that facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across the bacterial membrane. Like other P4 ATPases, this flippase activity is crucial for establishing and maintaining membrane asymmetry, which impacts various cellular processes including vesicular transport, signal transduction, and membrane remodeling . In particular, the arnF subunit is believed to participate in lipopolysaccharide (LPS) modification that contributes to antibiotic resistance mechanisms by altering the bacterial outer membrane permeability.

How does the structure of Shigella sonnei arnF compare to other bacterial flippases?

While specific structural data for S. sonnei arnF is still emerging, comparative analysis with other bacterial flippases suggests it likely shares conserved architectural features with P4 ATPases. These typically include multiple transmembrane domains that form a substrate translocation pathway, nucleotide-binding domains for ATP hydrolysis, and actuator domains that undergo conformational changes during the catalytic cycle . Unlike P4A ATPases which function as heterodimers with accessory β-subunits, arnF likely operates as part of a monomeric P4B-like flippase system, utilizing a structurally conserved mechanism for substrate transport across the membrane bilayer .

What experimental systems are most appropriate for studying recombinant Shigella sonnei arnF?

For recombinant expression of S. sonnei arnF, several expression systems have proven effective, including E. coli, yeast, baculovirus, and mammalian cell systems . When selecting an appropriate system, researchers should consider factors such as post-translational modifications, protein folding requirements, and functional assay compatibility. For structural studies, purification from E. coli often provides sufficient quantities, while functional studies may benefit from expression in systems that more closely mimic the native membrane environment. Caenorhabditis elegans has also emerged as a valuable infection model for studying Shigella pathogenesis in vivo, allowing for examination of host-pathogen interactions and transcriptional responses .

How does arnF expression change during different stages of Shigella sonnei infection?

Temporal analysis of gene expression during Shigella infection reveals complex transcriptional regulation patterns. While specific data for arnF is limited, dual RNA sequencing studies of S. sonnei infection in C. elegans have demonstrated that bacterial gene expression undergoes significant changes between early (10 minutes) and late (24 hours) infection stages . At late infection stages, S. sonnei notably upregulates genes associated with biofilm formation and energy generation/conservation compared to S. flexneri . This suggests that arnF expression might similarly be regulated in response to infection progression, potentially coordinated with other virulence factors and stress response mechanisms to optimize pathogen survival and transmission.

What is the mechanistic basis for arnF-mediated lipid translocation in bacterial membranes?

The mechanistic basis for arnF-mediated lipid translocation likely follows the conserved catalytic cycle observed in P4-ATPase flippases. This process involves distinct conformational states (E1-ATP, E2P-transition, and E2P) that facilitate substrate recognition, binding, and translocation . The cycle begins with ATP binding in the E1 state, followed by phosphorylation and transition to the E2P state, which allows substrate capture from one leaflet of the membrane. Subsequent conformational changes release the substrate into the opposite leaflet before dephosphorylation returns the flippase to its initial state . This ATP-dependent mechanism enables arnF to transport specific lipid substrates against concentration gradients, contributing to membrane asymmetry that is crucial for S. sonnei pathogenesis.

How does the interaction between arnF and host cell membranes contribute to Shigella sonnei pathogenesis?

The interaction between arnF and host cell membranes likely contributes to S. sonnei pathogenesis through multiple mechanisms. By modifying bacterial membrane composition, arnF may help S. sonnei evade host immune responses and resist antimicrobial compounds. Research on S. sonnei infection in C. elegans has shown that the bacterium can specifically downregulate host sphingolipid metabolism, cadmium ion response, and xenobiotic response pathways . These alterations in host cell function may be partially mediated by membrane modifications dependent on flippase activity. Additionally, the membrane remodeling functions associated with flippases can facilitate vesicle budding and other processes critical for bacterial invasion, intracellular survival, and intercellular spread .

What are the optimal conditions for expressing and purifying functional recombinant Shigella sonnei arnF protein?

Optimal expression and purification of functional S. sonnei arnF requires careful consideration of membrane protein handling techniques. For expression, a construct containing the complete coding sequence (amino acids 1-551 or equivalent, depending on the specific protein) should be cloned into an appropriate vector with an affinity tag (His6 or equivalent) for purification . Expression in E. coli membrane fractions typically yields sufficient protein, with induction at lower temperatures (18-20°C) often improving proper folding. For purification, solubilization with mild detergents (DDM, LMNG, or similar) helps maintain protein integrity while extracting it from membranes.

A recommended purification protocol involves:

  • Membrane isolation via differential centrifugation

  • Solubilization with selected detergent (1-2% w/v) for 1-2 hours

  • Affinity chromatography using Ni-NTA or equivalent resin

  • Size exclusion chromatography for final polishing

Storage conditions should include 10-20% glycerol, reducing agent, and detergent at concentrations above CMC to prevent protein aggregation and maintain stability at -80°C.

What assays can effectively measure the flippase activity of recombinant arnF protein?

Several complementary assays can effectively measure the flippase activity of recombinant arnF protein:

  • NBD-labeled lipid translocation assay: This fluorescence-based assay utilizes NBD-labeled lipid analogs to track their movement between membrane leaflets. After incorporation into liposomes containing reconstituted arnF, fluorescence changes (due to dithionite quenching of outer leaflet NBD-lipids) can be measured over time to quantify flippase activity.

  • ATPase activity coupling: Since flippase function is ATP-dependent, measuring ATPase activity through phosphate release assays (malachite green or enzyme-coupled) can serve as a proxy for flippase function when performed with and without lipid substrates.

  • In vivo functional complementation: Genetic complementation of arnF-deficient bacterial strains with recombinant constructs can demonstrate functional activity through restoration of phenotypes such as antibiotic resistance or membrane asymmetry.

  • Structure-guided mutagenesis: Similar to approaches used with other flippases, structure-guided mutagenesis of residues in the proposed substrate translocation path can disrupt the protein's ability to establish membrane asymmetry, providing insight into functional mechanisms .

How can researchers effectively use Caenorhabditis elegans as a model system for studying arnF function during Shigella sonnei infection?

C. elegans provides an excellent model system for studying arnF function during S. sonnei infection due to its genetic tractability and transparent body allowing for visual tracking of infection progression. To effectively utilize this model:

  • Synchronized infection protocol: Maintain age-synchronized worm populations (typically L4 to young adult stage) for consistent infection outcomes. Expose worms to S. sonnei on NGM plates for defined time periods (10 minutes for early infection, 24 hours for late infection) .

  • Transcriptomic analysis: Implement dual RNA sequencing to simultaneously analyze host and pathogen transcriptional responses. This approach can reveal how arnF expression correlates with infection stages and host defense responses .

  • Survival and behavioral assays: Quantify infection severity through survival curves and behavioral changes (movement, pharyngeal pumping, etc.). Compare wild-type S. sonnei with arnF mutants to assess the role of this flippase subunit in virulence.

  • Microscopy techniques: Utilize fluorescence microscopy with GFP-labeled bacteria to track colonization patterns and bacterial load in the intestinal lumen, complemented by transmission electron microscopy to observe ultrastructural changes in host and bacterial membranes.

  • Bacterial recovery assays: Quantify bacterial burden through grinding and plating of infected worms at various timepoints, comparing wild-type and mutant strains to determine the impact of arnF on bacterial persistence .

How should researchers interpret conflicting results between in vitro flippase assays and in vivo infection models?

When confronted with conflicting results between in vitro flippase assays and in vivo infection models, researchers should consider several interpretive frameworks:

  • Contextual differences: In vitro systems lack the complex host-pathogen interactions present in vivo. For example, dual RNA sequencing of S. sonnei infection in C. elegans revealed that sphingolipid metabolism in the host is specifically downregulated during S. sonnei infection but not during S. flexneri infection . Such host responses may significantly alter flippase activity or requirements in vivo.

  • Regulatory networks: ArnF function may be subject to complex regulatory mechanisms in vivo that are absent in purified systems. Transcriptomic studies have shown that S. sonnei upregulates biofilm formation and energy generation genes during infection , suggesting that arnF regulation might similarly depend on infection-specific signals.

  • Methodological considerations: Technical limitations of in vitro assays (detergent effects, artificial membrane compositions, absence of protein partners) may fail to recapitulate the native environment of arnF. Researchers should validate findings using multiple complementary approaches, potentially including structure-guided mutagenesis to confirm the proposed substrate translocation mechanism .

  • Experimental validation strategy: When conflicts arise, researchers should systematically evaluate each experimental system by:

    • Testing intermediate models (e.g., reconstituted membrane systems with increasing complexity)

    • Examining time-dependent effects that might reconcile apparent contradictions

    • Investigating potential regulatory factors present in vivo but absent in vitro

What statistical approaches are most appropriate for analyzing changes in membrane lipid composition related to arnF activity?

When analyzing changes in membrane lipid composition related to arnF activity, several statistical approaches are particularly valuable:

  • Multivariate analyses: Principal Component Analysis (PCA) and Partial Least Squares Discriminant Analysis (PLS-DA) can effectively identify patterns in complex lipidomic datasets. As demonstrated in the analysis of dual RNA sequencing data from Shigella infections, PCA can reveal clustering of experimental conditions that might not be apparent in univariate analyses .

  • Time-series analysis: Since membrane composition changes dynamically during infection, time-series statistical methods can identify temporal patterns. Analysis of both early (10 minutes) and late (24 hours) infection stages has proven informative in understanding Shigella pathogenesis .

  • Pathway enrichment analysis: Rather than focusing on individual lipid species, analyzing changes in lipid classes or biosynthetic pathways often provides more robust insights. This approach aligns with findings that S. sonnei specifically affects host sphingolipid metabolism pathways .

  • Multiple hypothesis testing correction: When profiling numerous lipid species simultaneously, researchers must apply appropriate corrections (Benjamini-Hochberg, Bonferroni, etc.) to control false discovery rates.

  • Longitudinal mixed models: For in vivo experiments tracking infection progression, longitudinal mixed models can account for subject-specific variation while identifying consistent effects of arnF manipulation.

How can researchers effectively integrate structural data with functional assays to elucidate the mechanism of arnF-mediated lipid translocation?

Effectively integrating structural data with functional assays requires a systematic approach that spans from molecular structures to in vivo function:

  • Structure-guided mutagenesis pipeline:

    • Identify conserved residues in the predicted substrate translocation pathway based on structural data

    • Generate point mutations at these sites

    • Test mutants in ATPase activity assays and lipid translocation assays in vitro

    • Validate functional consequences in bacterial membrane asymmetry assays

    • Confirm in vivo relevance through infection models

  • Conformational state analysis: Capture arnF in different conformational states (E1-ATP, E2P-transition, E2P) to understand the complete catalytic cycle, similar to approaches used with other P4 ATPases . Combine structural data with kinetic measurements of ATP hydrolysis and lipid translocation to correlate structural changes with functional outcomes.

  • Computational approaches: Molecular dynamics simulations can bridge static structural snapshots, predicting dynamic behaviors and energy landscapes of the translocation process. These predictions can then guide functional experiments.

  • Cross-validation framework: The table below outlines a systematic approach for integrating multiple data types:

Structural FeaturePredicted FunctionMutation StrategyFunctional AssayExpected Outcome
Entry gate residuesSubstrate recognitionConservative substitutionsNBD-lipid binding assaysAltered substrate specificity
ATP binding pocketEnergy transductionWalker A/B motif mutationsATPase activity measurementReduced ATP hydrolysis
Pivot pointsConformational changesProline insertions/substitutionsTransition state trappingBlocked catalytic cycle
Exit pathwaySubstrate releaseHydrophobic/charge alterationsDithionite accessibility assayDelayed substrate translocation
Regulatory domainsActivity modulationTruncation/chimeric constructsResponse to infection signalsAltered regulation in vivo
  • Translational integration: Ultimately, relate structural and functional findings to S. sonnei pathogenesis by examining how structure-based mutations affect bacterial survival, antibiotic resistance, and virulence in infection models like C. elegans .

What emerging technologies could advance our understanding of arnF function in antimicrobial resistance mechanisms?

Several emerging technologies hold particular promise for elucidating arnF function in antimicrobial resistance:

  • Cryo-electron microscopy advancements: Recent developments in cryo-EM have revolutionized membrane protein structural biology, potentially allowing visualization of arnF in different conformational states and in complex with native lipid substrates. As demonstrated with other flippases, capturing multiple conformational states (E1-ATP, E2P-transition, E2P) provides crucial insights into the transport mechanism .

  • Single-molecule techniques: FRET-based approaches and high-speed AFM can track real-time conformational changes in individual arnF molecules during the catalytic cycle, revealing dynamic aspects not captured in static structural models.

  • Native mass spectrometry: This technique can identify specific lipid-protein interactions and regulatory post-translational modifications that modulate arnF function during infection and antimicrobial exposure.

  • CRISPR-based screening: Genome-wide CRISPR screens in S. sonnei can identify genetic interactions with arnF, revealing functional partners and regulatory networks that contribute to antimicrobial resistance phenotypes.

  • Microfluidic infection models: These systems enable precise control of infection conditions and real-time monitoring of bacterial responses to antimicrobials, allowing quantitative assessment of how arnF contributes to resistance mechanisms across diverse environmental conditions.

How might targeting arnF function lead to novel therapeutic strategies against multidrug-resistant Shigella sonnei?

Targeting arnF function presents several promising therapeutic avenues against multidrug-resistant S. sonnei:

  • Direct flippase inhibitors: Structure-guided development of small molecules that bind to conserved regions of the substrate translocation pathway could disrupt arnF function. The conserved architecture observed across P4 ATPases suggests that key functional sites could be specifically targeted .

  • Allosteric modulators: Compounds that lock arnF in particular conformational states (similar to approaches with ion channels) could prevent the complete catalytic cycle required for lipid translocation.

  • Membrane perturbation strategies: Adjuvants that alter membrane properties could synergize with existing antibiotics by preventing arnF-mediated membrane modifications that contribute to antibiotic resistance.

  • Combination therapy approaches: Given that S. sonnei infection affects host sphingolipid metabolism , combining arnF inhibitors with modulators of host lipid responses could provide synergistic therapeutic effects by simultaneously targeting pathogen and host pathways.

  • Vaccination strategies: Recombinant arnF protein or peptides derived from extracellular domains could serve as vaccine antigens, potentially generating neutralizing antibodies that inhibit flippase function upon bacterial exposure to serum.

What comparative genomic approaches could elucidate the evolution of arnF across Shigella species and its relation to changing patterns of shigellosis epidemiology?

The shifting global epidemiology of shigellosis, marked by S. sonnei's emergence as the predominant species, warrants comprehensive comparative genomic investigation of arnF:

  • Phylogenetic analysis across Shigella species: By constructing phylogenetic trees of arnF sequences from clinical isolates spanning different geographical regions and time periods, researchers can trace the evolutionary trajectory of this flippase subunit and identify signatures of selection that might correlate with the observed shift from S. flexneri to S. sonnei predominance .

  • Structural variation mapping: Beyond sequence conservation, analyzing structural variants in the arnF gene and its regulatory regions can reveal adaptations that enhance functional efficiency or alter expression patterns in response to changing selective pressures.

  • Horizontal gene transfer assessment: Comparative genomics can identify potential horizontal gene transfer events involving arnF or associated flippase components, potentially explaining rapid acquisition of new functional capabilities or antimicrobial resistance mechanisms.

  • Transcriptomic correlation studies: Integrating genomic data with transcriptomic profiles from infection models can reveal how genetic variations in arnF correlate with expression patterns under different infection conditions. Dual RNA sequencing approaches, as used in C. elegans infection studies, are particularly valuable for simultaneously tracking pathogen and host responses .

  • Epidemiological data integration: Correlating arnF genetic variants with clinical outcomes, geographical distribution, and antimicrobial resistance profiles can help explain the expanding global footprint of S. sonnei and inform targeted intervention strategies for specific variant lineages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.