Gene Name: yciB
Protein Name: Probable intracellular septation protein A
UniProt ID: Q3Z0Y2
Organism: Shigella sonnei (strain Ss046)
Expression System: E. coli
Molecular Weight: ~20 kDa (calculated from 179-amino-acid sequence) .
Sequence: Full-length protein (residues 1–179) :
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Storage: Tris-based buffer with 50% glycerol; stable at -20°C/-80°C .
| Feature | S. sonnei yciB | S. flexneri yciB |
|---|---|---|
| UniProt ID | Q3Z0Y2 | Q0T5E2 |
| Strain | Ss046 | 8401 |
| Expression Region | 1–179 | 1–179 |
| Critical Residue (179) | MLGK | MLSK |
| Gene Locus | SSON_1912 | SFV_1268 |
Recombinant yciB is primarily utilized for:
Antibody Production: Immunogen for generating polyclonal or monoclonal antibodies .
Mechanistic Studies: Investigating septation protein interactions in Gram-negative pathogens.
Structural Biology: Crystallization trials to resolve 3D architecture .
No direct in vivo virulence data for S. sonnei yciB exists in the reviewed literature.
Functional insights are extrapolated from homologs (e.g., Pseudomonas YfiB) involved in cyclic-di-GMP signaling and biofilm regulation .
Functional Knockout Studies: To elucidate yciB’s role in S. sonnei cell division and virulence.
Therapeutic Target Exploration: Screening inhibitors against septation machinery for antimicrobial development.
KEGG: ssn:SSON_1912
Intracellular septation protein A (yciB) in S. sonnei is predicted to be involved in bacterial cell division processes. While specific structural data for S. sonnei yciB is limited, it likely contains multiple transmembrane domains typical of septation proteins. The protein is believed to participate in the formation of the septum during bacterial cell division, potentially interacting with other components of the divisome complex .
The function can be experimentally determined through:
Homology modeling using related proteins
Structural prediction using tools like AlphaFold or RoseTTAFold
Complementation studies with known septation proteins in model organisms
Localization studies using fluorescent protein fusions
Expression of yciB may vary across the phylogenetically diverse lineages of S. sonnei identified in recent genomic studies. Analysis of complete genome sequences from the 15 representative S. sonnei isolates shows evidence of ongoing adaptive evolution, featuring accumulation of insertion sequences, gene pseudogenisation, and structural variation . Researchers should consider:
Performing comparative transcriptomic analysis across lineages
Using qRT-PCR to quantify expression levels in different isolates
Analyzing promoter regions for potential regulatory differences
Correlating expression patterns with lineage-specific phenotypes
The regulation of yciB during S. sonnei infection likely involves complex environmental sensing mechanisms. S. sonnei possesses sophisticated virulence mechanisms including type III secretion system (T3SS) and type VI secretion system (T6SS) . Research approaches should include:
In vitro infection models to monitor expression during different stages
Reporter constructs to visualize expression in real-time
Analysis of upstream regulatory elements
Investigation of potential regulatory cross-talk with virulence systems
For optimal expression of recombinant S. sonnei yciB, researchers should consider:
Expression system comparison:
| Expression System | Advantages | Limitations | Purification Strategy |
|---|---|---|---|
| E. coli BL21(DE3) | High yield, similar codon usage to S. sonnei | Potential toxicity issues | IMAC with C-terminal His-tag |
| Cell-free systems | Avoids toxicity issues | Lower yield, higher cost | Direct purification from reaction mix |
| S. sonnei expression | Native environment, proper folding | Pathogenicity concerns, lower yield | Gentle lysis, affinity chromatography |
The choice should be guided by the specific experimental goals. For structural studies requiring large amounts of protein, E. coli systems with codon optimization may be preferable. For functional studies, ensuring proper folding and post-translational modifications may be critical.
Purifying membrane proteins like yciB presents significant challenges. Effective strategies include:
Detergent screening using a panel of mild, non-denaturing detergents (DDM, LMNG, etc.)
Optimization of solubilization conditions (temperature, pH, ionic strength)
Use of nanodiscs or amphipols to maintain native membrane environment
Implementing gentle affinity purification techniques
Size exclusion chromatography as a final polishing step
For functional studies, consider reconstitution into proteoliposomes following purification to maintain native-like membrane environment.
Creating and characterizing yciB knockout mutants requires careful consideration of S. sonnei's genetic manipulation challenges:
Generation strategies:
CRISPR-Cas9 mediated deletion
Homologous recombination with antibiotic resistance markers
Transposon mutagenesis with site-specific targeting
Validation approaches:
PCR verification of deletion
Western blotting to confirm protein absence
Whole genome sequencing to confirm clean deletion
Phenotypic characterization:
S. sonnei has developed significant antimicrobial resistance, including to ciprofloxacin and fluoroquinolones, which has intensified global spread and burden . To investigate yciB's potential role:
Compare minimum inhibitory concentrations (MICs) between wild-type and yciB knockout strains
Analyze expression changes in yciB during antibiotic exposure
Investigate potential interactions between yciB and known resistance mechanisms
Perform structural studies to identify potential antibiotic binding sites
Research suggests S. sonnei resistance to fluoroquinolone is due to sequential mutations (gyrA-S83L, parC-S80I, and gyrA-D87G), while a significant relationship exists between Integron (class II) and resistance development . Understanding yciB's role in this context requires integrating genomic, transcriptomic, and functional approaches.
Recent studies have identified that S. sonnei encodes a Type VI secretion system (T6SS) that allows it to outcompete other Enterobacteriaceae family members, including S. flexneri and E. coli . Investigating the relationship between yciB and T6SS requires:
Co-immunoprecipitation studies to identify physical interactions
Transcriptomic analysis to identify co-regulation patterns
Competition assays using wild-type and yciB mutant strains
Microscopy to visualize potential co-localization during infection
This investigation is particularly relevant given that T6SS is a key factor in S. sonnei's increasing prevalence globally.
Recent genomic characterization reveals significant phylogenetic diversity within S. sonnei populations, with multiple lineages associated with distinct epidemiological patterns . To investigate functional differences in yciB:
Perform comparative sequence analysis across the 15 representative lineages
Conduct complementation studies using yciB from different lineages
Analyze expression patterns in different genetic backgrounds
Correlate functional differences with lineage-specific adaptations
The completed genome sequences of 15 S. sonnei isolates, representing epidemiologically relevant and phylogenetically distinct genotypes, provide valuable resources for such comparative studies .
Comparative analysis of yciB requires:
Structural comparison table:
| Organism | Sequence Identity (%) | Key Structural Differences | Predicted Functional Implications |
|---|---|---|---|
| S. flexneri | ~95-98% (estimated) | Likely minimal differences | Similar function expected |
| E. coli | ~80-85% (estimated) | Potential differences in transmembrane domains | May affect membrane interaction |
| Other Enterobacteriaceae | Varies (~60-80%) | Variable loop regions and C-terminus | Potentially adapted to species-specific division machinery |
Research approaches should include:
Phylogenetic analysis to trace evolutionary history
Structural modeling to identify conserved domains
Complementation studies to test functional conservation
Analysis of selection pressures using dN/dS ratios
S. sonnei has shown a shifting pattern from developed to developing countries that requires explanation . The role of yciB in this epidemiological trend could be investigated by:
Comparing yciB sequences from isolates across geographical regions
Correlating yciB variants with virulence and transmission phenotypes
Investigating environmental adaptations that might involve septation proteins
Examining potential interactions with other factors contributing to S. sonnei's global emergence
This research is particularly relevant given that S. sonnei is now the second most common infectious species of shigellosis in low- and middle-income countries and the leading one in the developed world .
With increasing antimicrobial resistance in S. sonnei , novel targets are needed. For yciB-based approaches:
Structure-based drug design leveraging computational models
High-throughput screening for specific inhibitors
Peptide-based inhibitors targeting essential protein-protein interactions
CRISPR-based antimicrobials targeting the yciB gene
Any successful approach would require validation using:
In vitro activity assays
Cell culture infection models
Animal models of shigellosis
Resistance development assessment
Systems biology offers powerful tools to contextualize yciB function:
Genome-scale metabolic modeling to predict effects of yciB perturbation
Protein-protein interaction networks to identify functional partners
Multi-omics integration (genomics, transcriptomics, proteomics)
Machine learning approaches to predict phenotypic outcomes
The genome-scale metabolic models already produced for representative S. sonnei strains provide a foundation for such systems-level investigations.