Recombinant Shigella sonnei Probable intracellular septation protein A (yciB)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Basic Characteristics

Gene Name: yciB
Protein Name: Probable intracellular septation protein A
UniProt ID: Q3Z0Y2
Organism: Shigella sonnei (strain Ss046)
Expression System: E. coli

Key Features:

  • Molecular Weight: ~20 kDa (calculated from 179-amino-acid sequence) .

  • Sequence: Full-length protein (residues 1–179) :

    MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVVFGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLNLAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS

  • Tag: N-terminal 10×His tag for purification .

  • Storage: Tris-based buffer with 50% glycerol; stable at -20°C/-80°C .

Comparative Analysis of Recombinant yciB Proteins:

FeatureS. sonnei yciBS. flexneri yciB
UniProt IDQ3Z0Y2Q0T5E2
StrainSs0468401
Expression Region1–1791–179
Critical Residue (179)MLGKMLSK
Gene LocusSSON_1912SFV_1268

Research Applications

Recombinant yciB is primarily utilized for:

  1. Antibody Production: Immunogen for generating polyclonal or monoclonal antibodies .

  2. Mechanistic Studies: Investigating septation protein interactions in Gram-negative pathogens.

  3. Structural Biology: Crystallization trials to resolve 3D architecture .

Limitations in Current Knowledge:

  • No direct in vivo virulence data for S. sonnei yciB exists in the reviewed literature.

  • Functional insights are extrapolated from homologs (e.g., Pseudomonas YfiB) involved in cyclic-di-GMP signaling and biofilm regulation .

Future Directions

  • Functional Knockout Studies: To elucidate yciB’s role in S. sonnei cell division and virulence.

  • Therapeutic Target Exploration: Screening inhibitors against septation machinery for antimicrobial development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preferred format in the order notes section, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life can vary depending on several factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
yciB; SSON_1912; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
yciB
Target Protein Sequence
MKQFLDFLPLVVFFAFYKIYDIYAATAALIVATAIVLIYSWVRFRKVEKMALITFVLVVV FGGLTLFFHNDEFIKWKVTVIYALFAGALLVSQWVMKKPLIQRMLGKELTLPQPVWSKLN LAWAVFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGIYIYRHMPQEDKS
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of S. sonnei intracellular septation protein A (yciB)?

Intracellular septation protein A (yciB) in S. sonnei is predicted to be involved in bacterial cell division processes. While specific structural data for S. sonnei yciB is limited, it likely contains multiple transmembrane domains typical of septation proteins. The protein is believed to participate in the formation of the septum during bacterial cell division, potentially interacting with other components of the divisome complex .

The function can be experimentally determined through:

  • Homology modeling using related proteins

  • Structural prediction using tools like AlphaFold or RoseTTAFold

  • Complementation studies with known septation proteins in model organisms

  • Localization studies using fluorescent protein fusions

How does yciB expression vary across different S. sonnei lineages?

Expression of yciB may vary across the phylogenetically diverse lineages of S. sonnei identified in recent genomic studies. Analysis of complete genome sequences from the 15 representative S. sonnei isolates shows evidence of ongoing adaptive evolution, featuring accumulation of insertion sequences, gene pseudogenisation, and structural variation . Researchers should consider:

  • Performing comparative transcriptomic analysis across lineages

  • Using qRT-PCR to quantify expression levels in different isolates

  • Analyzing promoter regions for potential regulatory differences

  • Correlating expression patterns with lineage-specific phenotypes

What is known about the regulation of yciB expression during S. sonnei infection?

The regulation of yciB during S. sonnei infection likely involves complex environmental sensing mechanisms. S. sonnei possesses sophisticated virulence mechanisms including type III secretion system (T3SS) and type VI secretion system (T6SS) . Research approaches should include:

  • In vitro infection models to monitor expression during different stages

  • Reporter constructs to visualize expression in real-time

  • Analysis of upstream regulatory elements

  • Investigation of potential regulatory cross-talk with virulence systems

What are the optimal expression systems for producing recombinant S. sonnei yciB?

For optimal expression of recombinant S. sonnei yciB, researchers should consider:

Expression system comparison:

Expression SystemAdvantagesLimitationsPurification Strategy
E. coli BL21(DE3)High yield, similar codon usage to S. sonneiPotential toxicity issuesIMAC with C-terminal His-tag
Cell-free systemsAvoids toxicity issuesLower yield, higher costDirect purification from reaction mix
S. sonnei expressionNative environment, proper foldingPathogenicity concerns, lower yieldGentle lysis, affinity chromatography

The choice should be guided by the specific experimental goals. For structural studies requiring large amounts of protein, E. coli systems with codon optimization may be preferable. For functional studies, ensuring proper folding and post-translational modifications may be critical.

What are effective strategies for purifying recombinant yciB while maintaining its native conformation?

Purifying membrane proteins like yciB presents significant challenges. Effective strategies include:

  • Detergent screening using a panel of mild, non-denaturing detergents (DDM, LMNG, etc.)

  • Optimization of solubilization conditions (temperature, pH, ionic strength)

  • Use of nanodiscs or amphipols to maintain native membrane environment

  • Implementing gentle affinity purification techniques

  • Size exclusion chromatography as a final polishing step

For functional studies, consider reconstitution into proteoliposomes following purification to maintain native-like membrane environment.

How can researchers effectively generate and characterize yciB knockout mutants in S. sonnei?

Creating and characterizing yciB knockout mutants requires careful consideration of S. sonnei's genetic manipulation challenges:

  • Generation strategies:

    • CRISPR-Cas9 mediated deletion

    • Homologous recombination with antibiotic resistance markers

    • Transposon mutagenesis with site-specific targeting

  • Validation approaches:

    • PCR verification of deletion

    • Western blotting to confirm protein absence

    • Whole genome sequencing to confirm clean deletion

  • Phenotypic characterization:

    • Growth curve analysis under various conditions

    • Microscopy to assess cell morphology and division defects

    • Virulence assessment in cell culture and animal models

    • Antibiotic susceptibility testing, given S. sonnei's known resistance patterns

How does yciB contribute to S. sonnei antimicrobial resistance mechanisms?

S. sonnei has developed significant antimicrobial resistance, including to ciprofloxacin and fluoroquinolones, which has intensified global spread and burden . To investigate yciB's potential role:

  • Compare minimum inhibitory concentrations (MICs) between wild-type and yciB knockout strains

  • Analyze expression changes in yciB during antibiotic exposure

  • Investigate potential interactions between yciB and known resistance mechanisms

  • Perform structural studies to identify potential antibiotic binding sites

Research suggests S. sonnei resistance to fluoroquinolone is due to sequential mutations (gyrA-S83L, parC-S80I, and gyrA-D87G), while a significant relationship exists between Integron (class II) and resistance development . Understanding yciB's role in this context requires integrating genomic, transcriptomic, and functional approaches.

What is the relationship between yciB and the Type VI secretion system (T6SS) in S. sonnei virulence?

Recent studies have identified that S. sonnei encodes a Type VI secretion system (T6SS) that allows it to outcompete other Enterobacteriaceae family members, including S. flexneri and E. coli . Investigating the relationship between yciB and T6SS requires:

  • Co-immunoprecipitation studies to identify physical interactions

  • Transcriptomic analysis to identify co-regulation patterns

  • Competition assays using wild-type and yciB mutant strains

  • Microscopy to visualize potential co-localization during infection

This investigation is particularly relevant given that T6SS is a key factor in S. sonnei's increasing prevalence globally.

How does yciB function differ across the phylogenetic lineages of S. sonnei?

Recent genomic characterization reveals significant phylogenetic diversity within S. sonnei populations, with multiple lineages associated with distinct epidemiological patterns . To investigate functional differences in yciB:

  • Perform comparative sequence analysis across the 15 representative lineages

  • Conduct complementation studies using yciB from different lineages

  • Analyze expression patterns in different genetic backgrounds

  • Correlate functional differences with lineage-specific adaptations

The completed genome sequences of 15 S. sonnei isolates, representing epidemiologically relevant and phylogenetically distinct genotypes, provide valuable resources for such comparative studies .

How does S. sonnei yciB compare structurally and functionally to homologs in other Enterobacteriaceae?

Comparative analysis of yciB requires:

Structural comparison table:

OrganismSequence Identity (%)Key Structural DifferencesPredicted Functional Implications
S. flexneri~95-98% (estimated)Likely minimal differencesSimilar function expected
E. coli~80-85% (estimated)Potential differences in transmembrane domainsMay affect membrane interaction
Other EnterobacteriaceaeVaries (~60-80%)Variable loop regions and C-terminusPotentially adapted to species-specific division machinery

Research approaches should include:

  • Phylogenetic analysis to trace evolutionary history

  • Structural modeling to identify conserved domains

  • Complementation studies to test functional conservation

  • Analysis of selection pressures using dN/dS ratios

What role might yciB play in S. sonnei's shift from developed to developing countries?

S. sonnei has shown a shifting pattern from developed to developing countries that requires explanation . The role of yciB in this epidemiological trend could be investigated by:

  • Comparing yciB sequences from isolates across geographical regions

  • Correlating yciB variants with virulence and transmission phenotypes

  • Investigating environmental adaptations that might involve septation proteins

  • Examining potential interactions with other factors contributing to S. sonnei's global emergence

This research is particularly relevant given that S. sonnei is now the second most common infectious species of shigellosis in low- and middle-income countries and the leading one in the developed world .

What are promising approaches for targeting yciB in antimicrobial development?

With increasing antimicrobial resistance in S. sonnei , novel targets are needed. For yciB-based approaches:

  • Structure-based drug design leveraging computational models

  • High-throughput screening for specific inhibitors

  • Peptide-based inhibitors targeting essential protein-protein interactions

  • CRISPR-based antimicrobials targeting the yciB gene

Any successful approach would require validation using:

  • In vitro activity assays

  • Cell culture infection models

  • Animal models of shigellosis

  • Resistance development assessment

How might systems biology approaches enhance our understanding of yciB's role in S. sonnei pathogenesis?

Systems biology offers powerful tools to contextualize yciB function:

  • Genome-scale metabolic modeling to predict effects of yciB perturbation

  • Protein-protein interaction networks to identify functional partners

  • Multi-omics integration (genomics, transcriptomics, proteomics)

  • Machine learning approaches to predict phenotypic outcomes

The genome-scale metabolic models already produced for representative S. sonnei strains provide a foundation for such systems-level investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.