Recombinant Shigella sonnei Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Shigella sonnei Prolipoprotein Diacylglyceryl Transferase (Lgt) is a bacterial enzyme critical for posttranslational modification of lipoproteins, enabling their anchoring to membranes. Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming thioether bonds essential for lipoprotein maturation . In S. sonnei, this enzyme is encoded by the lgt gene and plays a role in virulence and bacterial survival.

2.1. Protein Structure and Functional Domains

  • Gene: lgt (UniProt ID: Q3YY32) .

  • Enzyme Class: EC 2.4.99.- (transferase activity) .

  • Topology: Predicted to be an inner membrane protein with seven transmembrane segments in Gram-negative bacteria, as shown in Escherichia coli homologs .

  • Conserved Motifs: Contains a signature motif with invariant residues (e.g., Y26, N146, G154 in E. coli Lgt) critical for catalytic activity .

2.2. Recombinant Production

ParameterDetails
Expression HostEscherichia coli
Purity>85% (SDS-PAGE verified)
StorageLyophilized at -20°C/-80°C; reconstitute in sterile water with 50% glycerol
TagDetermined during manufacturing (varies by batch)

3.1. Biochemical Role

Lgt transfers a diacylglyceryl moiety to the thiol group of the conserved cysteine (+1 position) in prolipoproteins, initiating lipoprotein maturation . This step is essential for:

  • Outer membrane integrity in Gram-negative bacteria .

  • Virulence factor localization in Shigella .

3.2. Key Residues and Mutational Analysis

  • Essential Residues: Y26, N146, and G154 (absolute requirement); R143, E151, R239, and E243 (partial activity loss when mutated) .

  • Structural Stability: Conserved histidine residues (e.g., His103 in E. coli) are critical for membrane embedding and enzymatic activity .

4.1. Shigella sonnei Virulence

  • Lgt-modified lipoproteins contribute to immune evasion by resisting phagolysosomal acidification and antimicrobial peptides .

  • Loss of Lgt activity disrupts outer membrane integrity, increasing susceptibility to serum killing and antibiotics .

4.2. Comparison with Other Species

FeatureS. sonnei LgtE. coli LgtS. aureus Lgt
Sequence Identity100% (self)~24% identity ~24% identity
Membrane Topology7 transmembrane domains7 transmembrane domains5 transmembrane domains
EssentialityRequired for virulenceEssential for growth Not fully characterized

5.1. Antimicrobial Target Validation

  • Lgt inhibitors (e.g., small-molecule compounds) disrupt lipoprotein biogenesis, showing bactericidal effects against Acinetobacter baumannii and E. coli .

  • Depleting Lgt sensitizes S. sonnei to host defenses, highlighting its potential as a therapeutic target .

5.2. Vaccine Development

  • Lipoproteins modified by Lgt are immunogenic and may serve as antigenic targets in Shigella vaccines .

  • Recombinant Lgt aids in studying lipoprotein-dependent virulence mechanisms .

Clinical and Industrial Relevance

  • Antibiotic Resistance: Lgt-deficient S. sonnei strains show increased susceptibility to β-lactams and fluoroquinolones .

  • Biotechnological Use: Recombinant Lgt is utilized in structural studies and high-throughput inhibitor screening .

Future Directions

  • Structural Biology: Cryo-EM studies to resolve full-length Lgt architecture.

  • Therapeutic Exploration: Development of Lgt-specific inhibitors to combat multidrug-resistant Shigella .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; SSON_2985; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
lgt
Target Protein Sequence
MTSSYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLATRRANRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPQFMADPLYLFRVWDGGMSFHGGLIGVIVVMIIFARRT KRSFFQVSDFIAPLIPFGLGAGRLGNFINGELWGRVDPNFPFAMLFPGSRTEDILLLQTN PQWQSIFDTYGVLPRHPSQLYELLLEGVVLFIILNLYIRKPRPMGAVSGLFLIGYGAFRI IVEFFRQPDAQFTGAWVQYISMGQILSIPMIVAGVIMMVWAYRRSPQQHVS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella sonnei Prolipoprotein diacylglyceryl transferase (lgt) and why is it significant?

Prolipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme that catalyzes the first step in bacterial lipoprotein biogenesis - specifically, the transfer of a diacylglyceryl moiety from phosphatidylglycerol to prolipoprotein substrates. This post-translational modification is essential for bacterial survival, particularly in Gram-negative bacteria like Shigella sonnei. Deletion of the lgt gene has been demonstrated to be lethal to most Gram-negative bacteria, highlighting its critical importance . In S. sonnei, lgt plays a crucial role in the proper localization and function of numerous lipoproteins that contribute to cell envelope architecture, nutrient uptake, transport, and virulence mechanisms, making it an attractive target for antimicrobial development .

How does the lgt enzyme function in bacterial systems?

Lgt functions by catalyzing the transfer of a diacylglyceryl group from the phospholipid phosphatidylglycerol to a conserved cysteine residue in the "lipobox" motif of target prolipoproteins. This reaction represents the first of three sequential post-translational modifications in the lipoprotein biogenesis pathway . Crystal structure analyses have revealed that Lgt contains two binding sites and possesses critical residues, including Arg143 and Arg239, that are essential for diacylglyceryl transfer activity . The enzyme facilitates the lateral entry of substrates and the exit of products relative to the lipid bilayer. This mechanism is supported by both structural and biochemical data, including complementation results from lgt-knockout cells with different mutant Lgt variants and GFP-based in vitro assays that correlated enzyme activities with structural observations .

What is known about the structure-function relationship of Lgt?

The crystal structures of E. coli Lgt (closely related to S. sonnei Lgt) have been determined at high resolution (1.9 Å and 1.6 Å) in complex with phosphatidylglycerol and the inhibitor palmitic acid, respectively . These structures have revealed key insights into the enzyme's mechanism:

Structural FeatureFunctional Significance
Two binding sitesAccommodate phosphatidylglycerol substrate and prolipoprotein acceptor
Critical Arg143 and Arg239 residuesEssential for diacylglyceryl transfer activity
Lateral substrate entry/product exitFacilitates interaction with membrane-embedded substrates
Conserved catalytic residuesMediate the transfer reaction with high specificity

These structural insights provide a foundation for understanding the catalytic mechanism of Lgt and for the rational design of inhibitors targeting this essential enzyme .

What expression systems and purification protocols yield optimal results for recombinant S. sonnei Lgt?

For recombinant expression of S. sonnei Lgt, E. coli-based expression systems have proven effective, particularly when using specialized strains designed for membrane protein expression. Based on protocols established for E. coli Lgt, which shares high sequence homology with S. sonnei Lgt, researchers should consider the following methodological approach:

  • Expression vector selection: pET-based vectors with an N-terminal His-tag or similar affinity tag facilitate purification while preserving enzymatic activity.

  • Expression conditions: Induction at lower temperatures (16-20°C) after reaching mid-log phase (OD600 ~0.6-0.8) using reduced IPTG concentrations (0.1-0.5 mM) often maximizes the yield of properly folded protein.

  • Membrane fraction preparation: Gentle cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Detergent solubilization: Careful screening of detergents is critical, with n-dodecyl-β-D-maltopyranoside (DDM) often providing a good balance between protein stability and activity preservation.

  • Purification strategy: A two-step purification using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography typically yields protein of sufficient purity for biochemical and structural studies .

The critical challenge in working with Lgt is maintaining its stability and activity throughout the purification process, given its nature as an integral membrane protein. Inclusion of phospholipids or lipid-like additives in the purification buffers can help maintain the native-like environment necessary for preserving enzymatic activity.

How can researchers effectively assay the enzymatic activity of recombinant S. sonnei Lgt?

Several complementary approaches can be employed to assess the enzymatic activity of recombinant S. sonnei Lgt:

  • GFP-based in vitro assay: This approach involves using a fluorescently tagged substrate peptide containing the lipobox motif. The change in fluorescence properties upon diacylglyceryl transfer can be monitored in real-time, providing a sensitive measure of enzymatic activity .

  • Complementation assays: Functional complementation of lgt-knockout cells with recombinant Lgt variants allows assessment of enzyme activity in a cellular context. This approach has been successfully used to identify critical residues, including Arg143 and Arg239, that are essential for diacylglyceryl transfer .

  • Radiolabeled substrate incorporation: Using radiolabeled phosphatidylglycerol substrates enables sensitive detection of diacylglyceryl transfer to acceptor peptides through scintillation counting or autoradiography.

  • Mass spectrometry-based approaches: LC-MS/MS analysis can provide detailed characterization of lipidated peptide products, allowing both qualitative and quantitative assessment of enzymatic activity.

When designing activity assays, researchers should carefully consider buffer composition, detergent concentration, and substrate presentation to ensure optimal enzyme performance. Control experiments with known inhibitors (such as palmitic acid) or catalytically inactive mutants should be included to validate assay specificity.

What are the implications of Lgt inhibition for S. sonnei virulence and pathogenicity?

Inhibition of Lgt in S. sonnei would likely have profound effects on virulence and pathogenicity due to the essential role of lipoproteins in bacterial physiology and host-pathogen interactions. The following aspects should be considered:

  • Cell envelope integrity: Lipoproteins modified by Lgt are critical for maintaining the structure and function of the bacterial cell envelope. Disruption of this process would likely compromise membrane integrity and bacterial survival .

  • Type VI secretion system (T6SS): S. sonnei encodes T6SS, which gives it a competitive advantage over other Enterobacteriaceae family members like S. flexneri and E. coli. This system requires proper lipoprotein processing for assembly and function .

  • Antimicrobial resistance: S. sonnei has demonstrated increased acquisition of antimicrobial resistance genes through mobile genetic elements. Many components of resistance mechanisms rely on properly processed lipoproteins, making Lgt inhibition a potential strategy to increase susceptibility to existing antibiotics .

  • Host immune evasion: S. sonnei has evolved mechanisms to evade host immune responses, including downregulation of antimicrobial peptides and modulation of dendritic cell function. Lipoproteins play crucial roles in these processes, and disruption of their biogenesis through Lgt inhibition could potentially reduce immune evasion capabilities .

  • Competitive fitness: S. sonnei produces colicins and mucinases that kill phylogenetically related bacteria, providing a competitive advantage. These mechanisms may depend on properly processed lipoproteins, suggesting that Lgt inhibition could reduce competitive fitness in polymicrobial environments .

Given these considerations, Lgt represents a promising target for novel antimicrobial strategies against S. sonnei, particularly in light of increasing antibiotic resistance patterns observed in clinical isolates.

How does the structure of S. sonnei Lgt compare with that of other bacterial species?

While specific structural data for S. sonnei Lgt is limited, insights can be drawn from the high-resolution structures of E. coli Lgt, which shares significant sequence homology with S. sonnei Lgt:

Comparative genomic analyses have revealed that S. sonnei has evolved distinct virulence mechanisms compared to other Shigella species, including the acquisition of specific lipopolysaccharide structures from environmental bacteria like Plesiomonas shigelloides . These unique features may influence the substrate specificity and regulatory mechanisms of S. sonnei Lgt, potentially providing opportunities for species-specific targeting strategies.

Future structural studies focusing specifically on S. sonnei Lgt would be valuable for identifying any unique features that could be exploited for the development of targeted inhibitors.

What are the challenges in crystallizing membrane proteins like S. sonnei Lgt?

Crystallizing membrane proteins like S. sonnei Lgt presents several significant challenges that researchers must address:

  • Protein stability: Membrane proteins are often unstable when removed from their native lipid environment. Researchers should screen multiple detergents and lipid additives to identify conditions that maintain Lgt in a stable, properly folded state.

  • Crystal packing: The presence of detergent micelles around the hydrophobic regions of membrane proteins can hinder the formation of crystal contacts. Techniques like lipidic cubic phase crystallization or the use of crystallization chaperones may help overcome this limitation.

  • Conformational heterogeneity: Membrane proteins often exhibit conformational flexibility, which can impede crystal formation. Binding of substrates, inhibitors, or antibody fragments can stabilize specific conformations and promote crystallization.

  • Expression and purification yields: Obtaining sufficient quantities of pure, homogeneous protein remains a major challenge. Optimization of expression systems, fusion partners, and purification protocols is essential.

Based on the successful crystallization of E. coli Lgt (at 1.9 Å and 1.6 Å resolution), researchers studying S. sonnei Lgt should consider similar approaches, including co-crystallization with phosphatidylglycerol or palmitic acid to stabilize the protein in a defined conformational state .

How can researchers design effective inhibitors targeting S. sonnei Lgt?

Designing effective inhibitors for S. sonnei Lgt requires a multifaceted approach:

  • Structure-based design: Utilizing the structural insights from E. coli Lgt crystal structures, researchers can identify potential binding pockets and design molecules that interact with critical catalytic residues like Arg143 and Arg239 .

  • Substrate mimetics: Developing compounds that mimic the natural phosphatidylglycerol substrate but contain non-hydrolyzable modifications could create competitive inhibitors of the enzyme.

  • High-throughput screening: Establishing robust activity assays (such as the GFP-based assay mentioned previously) enables screening of compound libraries to identify novel inhibitor scaffolds .

  • Fragment-based approaches: Starting with small molecular fragments that bind to specific regions of the enzyme and gradually expanding them through medicinal chemistry optimization can lead to potent, selective inhibitors.

  • Consideration of membrane permeability: Any potential inhibitor must be able to access the enzyme within the bacterial membrane, requiring careful optimization of physicochemical properties.

The discovery that palmitic acid acts as an inhibitor of E. coli Lgt provides a starting point for inhibitor design, suggesting that fatty acid derivatives might serve as useful scaffolds for developing more potent and selective inhibitors .

How should researchers interpret conflicting data regarding S. sonnei Lgt function?

When faced with conflicting data regarding S. sonnei Lgt function, researchers should systematically address discrepancies through the following approaches:

  • Experimental conditions: Differences in expression systems, purification methods, detergent choices, and assay conditions can significantly impact observed enzymatic activities. Careful standardization and reporting of these parameters are essential for meaningful comparisons.

  • Protein constructs: Variations in protein constructs, including the presence and position of affinity tags or fusion partners, can influence enzyme behavior. Validation with multiple constructs or tag-free proteins can help resolve discrepancies.

  • Strain-specific differences: S. sonnei isolates may exhibit genetic variations that affect Lgt structure or function. Researchers should clearly document the specific strain used and consider sequencing the lgt gene to identify any polymorphisms.

  • Model systems: Studies using heterologous expression systems (e.g., E. coli) may yield results that differ from those observed in native S. sonnei. Complementation studies in lgt-knockout S. sonnei strains provide the most physiologically relevant context for functional analyses.

  • Substrate specificity: The choice of substrate (both phospholipid donor and prolipoprotein acceptor) can significantly impact observed activities. Systematic investigation using a panel of substrates can help resolve apparent conflicting results.

An illustrative example comes from studies of amoeba interactions with S. sonnei, where conflicting results were reported regarding bacterial survival. One study suggested that Acanthamoebae castellanii protected S. sonnei from environmental damage, while a later study showed that S. sonnei cannot survive or grow in the cytosol of A. castellanii . Such contradictions highlight the importance of carefully controlling experimental conditions and considering biological variables.

What advanced biophysical techniques are most informative for studying S. sonnei Lgt structure-function relationships?

Multiple complementary biophysical techniques can provide valuable insights into S. sonnei Lgt structure-function relationships:

TechniqueInformation ProvidedAdvantagesLimitations
X-ray crystallographyHigh-resolution static structureAtomic-level detail of protein-ligand interactionsRequires protein crystallization; provides static snapshots
Cryo-electron microscopyMedium to high-resolution structureCan capture multiple conformational statesLower resolution for small membrane proteins
Hydrogen-deuterium exchange mass spectrometry (HDX-MS)Conformational dynamics and ligand-induced changesWorks with detergent-solubilized protein; no size limitationLimited spatial resolution
Molecular dynamics simulationsDynamic behavior in membrane environmentProvides insights into conformational changes and water/lipid interactionsRequires validation with experimental data
Site-directed spin labeling with EPRDistances between specific residues; conformational changesCan probe dynamics in native-like membrane environmentRequires introduction of spin labels
Surface plasmon resonance (SPR)Binding kinetics and affinityReal-time monitoring of interactionsRequires immobilization of protein or ligand

A multi-technique approach combining structural methods with functional assays provides the most comprehensive understanding of Lgt. For example, the structural insights from X-ray crystallography of E. coli Lgt were complemented by functional data from complementation assays and GFP-based activity measurements to establish the catalytic mechanism .

What are the most promising avenues for advancing S. sonnei Lgt research?

Several promising research directions could significantly advance our understanding of S. sonnei Lgt and its potential as a therapeutic target:

  • Comparative structural biology: Determining the high-resolution structure of S. sonnei Lgt would enable precise comparison with E. coli Lgt and other bacterial orthologs, potentially revealing species-specific features that could be exploited for selective inhibitor design.

  • Substrate specificity profiling: Comprehensive analysis of S. sonnei Lgt substrate preferences using proteomic approaches would provide insights into which lipoproteins are most critical for bacterial fitness and virulence.

  • In vivo inhibition studies: Developing cell-penetrant Lgt inhibitors and evaluating their effects on S. sonnei growth, survival, and virulence in relevant infection models would validate this enzyme as a therapeutic target.

  • Resistance mechanisms: Investigating potential mechanisms by which S. sonnei might develop resistance to Lgt inhibitors would inform drug development strategies and combination approaches.

  • Structure-guided vaccine development: Lipoproteins processed by Lgt often serve as immunogenic components recognized by the host immune system. Structural insights into these lipoproteins could guide the development of vaccines targeting S. sonnei.

  • Interaction with host factors: Exploring how Lgt-modified lipoproteins interact with host immune components would enhance our understanding of S. sonnei pathogenesis and immune evasion strategies, such as the reported downregulation of antimicrobial peptides and modulation of dendritic cell function .

The emergence of hybrid pathotypes, such as Shiga toxin-producing S. sonnei strains, underscores the importance of continued surveillance and characterization of evolving virulence mechanisms in this pathogen .

How might inhibition of Lgt affect the broader Shigella virulence landscape?

Inhibition of Lgt would likely have profound and multifaceted effects on Shigella virulence:

  • Essential lipoproteins: Lgt is required for the proper processing of numerous lipoproteins essential for bacterial survival, making it a potentially bactericidal target .

  • Virulence factor deployment: Many virulence-associated structures, including secretion systems and adhesins, rely on properly processed lipoproteins for assembly and function. The type VI secretion system (T6SS) encoded by S. sonnei, which gives it a competitive advantage over other enteric bacteria, would likely be compromised by Lgt inhibition .

  • Antimicrobial resistance: S. sonnei has demonstrated increased acquisition of antimicrobial resistance genes compared to S. flexneri. Lgt inhibition could potentially resensitize resistant strains to existing antibiotics by compromising resistance mechanisms that depend on lipoproteins .

  • Competitive fitness: S. sonnei produces antibacterial factors like colicins that kill phylogenetically related bacteria. Studies have reported that 93% of S. sonnei strains contain at least one colicin-coding plasmid, and all tested strains from Bhutan carried ColE plasmid for colicin production. Disruption of lipoprotein processing could potentially affect these competitive mechanisms .

  • Global emergence: The multifactorial processes contributing to the global emergence of S. sonnei as a dominant pathogen, including its unique virulence mechanisms and adaptation to improved sanitation conditions, could be disrupted by targeting the fundamental process of lipoprotein biogenesis .

As S. sonnei continues to evolve, including the concerning emergence of Shiga toxin-producing strains, developing new antimicrobial strategies targeting conserved essential processes like Lgt-mediated lipoprotein modification represents a promising approach to address this global health challenge .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.