Recombinant Shigella sonnei Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Introduction to Shigella sonnei and CrcB Homolog

Shigella sonnei is a Gram-negative, rod-shaped bacterium and a prominent cause of shigellosis, a diarrheal disease, worldwide . Shigella infections lead to inflammatory colitis, with the bacterium invading through M cells of the gut-associated lymphoid tissue . A key area of research involves identifying and characterizing S. sonnei proteins that contribute to its virulence and pathogenicity. One such protein is the CrcB homolog.

The CrcB homolog in S. sonnei is a protein identified by the gene name crcB and the ordered locus name SSON_0578 . It is a protein CrcB homolog with a full length of 127 amino acids .

Characteristics of Recombinant Shigella sonnei Protein CrcB Homolog

Recombinant Shigella sonnei Protein CrcB homolog (crcB) is produced using recombinant DNA technology, where the gene encoding the CrcB homolog is cloned and expressed in a host organism such as E. coli . This allows for the production of large quantities of the protein for research and potential applications .

Key characteristics of the recombinant protein include:

  • Source: Typically expressed in E. coli, yeast, baculovirus, or mammalian cells .

  • Purity: High purity levels can be achieved through affinity chromatography and other purification techniques .

  • Storage: Generally stored at -20°C or -80°C in a Tris-based buffer with 50% glycerol to maintain stability . Repeated freezing and thawing are not recommended .

  • Sequence information: The protein is a full-length protein consisting of 127 amino acids .

Role and Significance of CrcB Homolog in Shigella sonnei

  • Virulence Mechanisms: The CrcB homolog may contribute to the bacterium's ability to colonize, invade, and cause disease in the host .

  • Stress Response: Proteins in the CrcB family are known to be involved in stress response mechanisms in bacteria, potentially aiding S. sonnei in survival under harsh conditions within the host .

  • Antibiotic Resistance: Research suggests a link between bacterial proteins and antibiotic resistance, indicating the CrcB homolog could play a role in the increasing antibiotic resistance observed in S. sonnei .

Applications in Vaccine Development and Research

Recombinant Shigella sonnei Protein CrcB homolog has several applications in vaccine development and scientific research:

  • Vaccine Development: Recombinant proteins like CrcB homolog can be used as antigens in subunit vaccines to elicit an immune response against S. sonnei .

  • Antibody Production: The recombinant protein can be used to generate specific antibodies for diagnostic and research purposes .

  • Structural Studies: Recombinant production allows for structural studies to understand the protein's function and interactions at a molecular level .

Immunogenicity and Protective Efficacy

Studies have explored the immunogenicity and protective efficacy of Shigella proteins, including VirG, as vaccine candidates . While there may not be direct studies on CrcB, the approach used for VirG can be applicable:

  • Immunogenicity: Recombinant VirGα was shown to elicit high levels of specific IgG antibodies in animal models .

  • Production: Recombinant VirGα was produced efficiently in E. coli, with high purity and low levels of host-cell proteins and endotoxins .

Tables and Data

The following tables present data related to the Recombinant Shigella sonnei Protein CrcB homolog:

Table 1: Characteristics of Recombinant Shigella sonnei Protein CrcB homolog

CharacteristicDescription
Protein NameProtein CrcB homolog
Gene NamecrcB
Ordered Locus NamesSSON_0578
Expression Region1-127 amino acids
SpeciesShigella sonnei (strain Ss046)
Uniprot NO.Q3Z4G8
Tag InfoDetermined during production process
Storage BufferTris-based buffer, 50% glycerol, optimized for the protein
StorageStore at -20℃, for extended storage, conserve at -20℃ or -80℃.
NotesRepeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA SequencemLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Expression Region1-127
Sequence InfoFull length protein

Table 2: Production and Purity of Recombinant VirGα Protein

ParameterValue
Production SystemE. coli
Recovery Yield6.2 mg/L culture
Purity>95%
Residual Host-Cell Proteins<1%
Endotoxin Units<20 EU/mg (detection limit)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
crcB; SSON_0578; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
crcB
Target Protein Sequence
MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL FSASTAH
Uniprot No.

Target Background

Function

Important for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used to produce recombinant Shigella sonnei CrcB homolog?

Multiple expression systems can be utilized to produce recombinant Shigella sonnei CrcB homolog, with each offering different advantages:

Expression SystemAdvantagesConsiderations
E. coli (BL21)High yield, cost-effective, rapid expressionMay require optimization of codon usage
YeastPost-translational modifications, proper foldingLower yield than bacterial systems
BaculovirusSuitable for complex proteins, post-translational modificationsMore complex setup, higher cost
Mammalian cellsMost authentic post-translational modificationsHighest cost, lower yield

E. coli-based expression systems are most commonly employed due to their efficiency and cost-effectiveness, particularly for bacterial proteins like CrcB . Expression in E. coli BL21(DE3) strain has been successfully demonstrated for many Shigella proteins, with optimal induction conditions typically involving IPTG induction when cultures reach an OD600 of 0.8-1.3 .

How should recombinant CrcB homolog protein be stored to maintain stability?

For optimal stability and activity preservation of recombinant Shigella sonnei CrcB homolog protein:

  • Store the lyophilized protein at -20°C for general storage

  • For extended storage, maintain at -20°C or preferably -80°C

  • Upon reconstitution, use a Tris-based buffer with 50% glycerol optimized for this specific protein

  • Avoid repeated freeze-thaw cycles as they can significantly degrade protein quality

  • For short-term use, store working aliquots at 4°C for no more than one week

When reconstituting lyophilized protein, it is recommended to briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 50% is recommended for long-term storage to prevent freeze-damage to protein structure .

What are the methodological approaches for detecting CrcB homolog expression?

Several analytical methods can be employed to detect and verify recombinant CrcB homolog expression:

  • SDS-PAGE Analysis: Allows visualization of the protein band at approximately 15 kDa (for the native protein) or slightly higher if tagged. Successful expression typically shows a distinct band corresponding to the target protein after induction.

  • Western Blot Detection: Utilizing either:

    • Anti-tag antibodies (if the recombinant protein includes a tag such as His-tag)

    • Custom antibodies raised against CrcB peptides

  • ELISA: Particularly useful for quantification of the expressed protein in complex samples.

  • Mass Spectrometry: For definitive identification and verification of the protein sequence.

For optimal results, apply at least two different detection methods to confirm expression and identity of the recombinant protein . When using western blotting, different denaturation temperatures may be needed as membrane proteins can form aggregates at higher temperatures.

How does homologous recombination influence the evolutionary dynamics of the crcB gene in Shigella sonnei strains?

Homologous recombination plays a critical role in shaping the evolutionary trajectory of genes like crcB in Shigella sonnei. Analysis of homologous recombination patterns indicates that:

  • Genes encoding basic cellular functions, including membrane proteins like CrcB, often experience significant recombination events across bacterial genomes.

  • The recombination rate appears relatively constant across the genome for most genes, including crcB, following a linear relationship between nucleotide diversity (π) and minimum number of recombination events .

  • Recombination can facilitate rapid adaptation to new environmental challenges by:

    • Introducing beneficial mutations from related strains

    • Creating mosaic structures in genes that may provide selective advantages

    • Enabling acquisition of new functional variants while maintaining core functionality

For crcB specifically, its role in membrane functions and potential involvement in resistance mechanisms makes it subject to selective pressures that may influence recombination rates. In Shigella species, the high genetic similarity to E. coli (they share >99% nucleotide identity for many genes) facilitates homologous recombination between these species, potentially introducing new functional variants of crcB .

Researchers investigating crcB evolution should employ population genomic approaches that account for both vertical inheritance and horizontal gene transfer through recombination to accurately capture its evolutionary dynamics.

What are the optimal experimental conditions for determining CrcB homolog protein-protein interactions in Shigella sonnei?

To effectively investigate protein-protein interactions (PPIs) of CrcB homolog in Shigella sonnei, multiple complementary approaches should be implemented:

In vitro methodologies:

  • Pull-down assays: Using recombinant biotinylated CrcB (via AviTag-BirA technology) as bait protein. This can be performed by:

    • Immobilizing biotinylated CrcB on streptavidin-coated beads

    • Incubating with Shigella cell lysates

    • Washing to remove non-specific binding

    • Eluting and analyzing interacting proteins by mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified CrcB on a sensor chip

    • Pass potential interacting proteins over the surface

    • Monitor real-time binding kinetics

    • Determine association/dissociation constants

In vivo approaches:

  • Bacterial Two-Hybrid System:

    • Construct fusion proteins of CrcB and potential interacting partners

    • Co-express in a reporter strain

    • Measure reporter gene activation as indicator of interaction

  • Co-Immunoprecipitation with crosslinking:

    • Apply in vivo crosslinking to capture transient interactions

    • Lyse cells and immunoprecipitate CrcB with specific antibodies

    • Identify co-precipitated proteins by mass spectrometry

Buffer optimization is critical for membrane proteins like CrcB:

  • Base buffer: 50 mM Tris-HCl, pH 7.5, 150 mM NaCl

  • Include mild detergents: 0.1% DDM or 0.5% CHAPS

  • Add stabilizers: 10% glycerol and 1 mM DTT

  • Consider adding specific ions based on putative function (e.g., NaF for fluoride transporter analysis)

These approaches should be used in combination to validate and characterize the full interactome of CrcB homolog protein.

What is the role of CrcB homolog in Shigella sonnei virulence and how can it be experimentally assessed?

The potential contribution of CrcB homolog to Shigella sonnei virulence remains under investigation, but several methodological approaches can be employed to assess its role:

Gene knockout and complementation studies:

  • Create a precise crcB deletion mutant using homologous recombination techniques

  • Construct complementation strains with wild-type or modified crcB variants

  • Compare phenotypes between wild-type, mutant, and complemented strains

Virulence assessment assays:

  • Invasion assays using human colonic epithelial cells (e.g., Caco-2, HT-29)

  • Contact-mediated hemolysis to evaluate T3SS functionality:

    • Grow bacteria on Congo-red agar to select virulent colonies

    • Incubate bacteria with red blood cells

    • Measure hemoglobin release spectrophotometrically at A545

  • Intracellular replication assessment in macrophage cell lines

  • Animal models of shigellosis, including:

    • Guinea pig keratoconjunctivitis test

    • Mouse pulmonary infection model

Stress resistance evaluation:
Since CrcB may function as a fluoride ion transporter, test growth and survival under:

  • Various fluoride ion concentrations

  • Different pH conditions

  • Antimicrobial compounds

Gene expression analysis:

  • Measure crcB expression under infection-relevant conditions

  • Identify co-regulated genes through transcriptomics

  • Determine if crcB expression correlates with known virulence factors

By integrating these approaches, researchers can determine whether CrcB homolog contributes directly to Shigella sonnei virulence mechanisms or plays an indirect role through stress adaptation and survival.

How does the structure-function relationship of CrcB homolog compare between Shigella sonnei and other enteric pathogens?

The structure-function relationship of CrcB homolog across enteric pathogens reveals important evolutionary and functional insights:

Structural conservation analysis:

OrganismSequence Identity to S. sonnei CrcBKey Structural Features
E. coli>95%Nearly identical transmembrane topology
Salmonella spp.85-90%Conserved core structure with variations in external loops
Vibrio cholerae70-75%Divergence in fluoride-binding residues
Yersinia spp.75-80%Variations in N-terminal region

Functional implications:

  • Fluoride channel activity: CrcB homologs typically function as fluoride ion channels or transporters, providing resistance to environmental fluoride toxicity. Mutational studies in related bacteria demonstrate that specific conserved residues in transmembrane domains are critical for this function.

  • Membrane integrity: The protein contains multiple transmembrane domains (evident from the sequence: "LQLLAVFIGGG...LIGAFIIGMGFAW...") that anchor it within the bacterial membrane, potentially contributing to membrane stability under stress conditions .

  • Antibiotic resistance connections: Some CrcB variants in related species have been implicated in antimicrobial resistance mechanisms, particularly for compounds that disrupt membrane potential.

To experimentally assess functional differences, researchers should:

  • Perform complementation studies with CrcB variants from different species in a CrcB knockout background

  • Conduct fluoride sensitivity assays under varying environmental conditions

  • Use protein modeling and site-directed mutagenesis to identify critical residues for function

  • Employ electrophysiology techniques to directly measure ion transport capabilities

The structure-function relationship of CrcB across enteric pathogens provides valuable insights into bacterial adaptation mechanisms and potential targets for antimicrobial development.

What methodological approaches can be used to study the interaction between CrcB homolog and antibiotic resistance mechanisms in Shigella sonnei?

Investigating the potential role of CrcB homolog in antibiotic resistance requires multifaceted experimental approaches:

Genetic correlation studies:

  • Genome-wide association studies (GWAS): Compare crcB sequences and expression levels between antibiotic-resistant and susceptible Shigella sonnei isolates.

  • Transcriptomic analysis: Profile gene expression changes in response to antibiotic exposure, focusing on crcB and related genes.

Functional validation experiments:

  • Gene deletion and complementation:

    • Create ΔcrcB mutants and measure changes in antimicrobial susceptibility

    • Complement with wild-type and mutant variants to confirm causality

    • Test against multiple antibiotic classes to determine specificity

  • Minimum Inhibitory Concentration (MIC) determination:

    • Compare MICs between wild-type, ΔcrcB, and overexpression strains

    • Test with and without fluoride ion supplementation

    • Include various antimicrobial agents, particularly those targeting membrane integrity

  • Membrane permeability assays:

    • Measure uptake of fluorescent dyes (e.g., propidium iodide, ethidium bromide)

    • Assess membrane potential using voltage-sensitive dyes

    • Quantify antibiotic accumulation in bacterial cells

Molecular mechanism investigation:

  • Protein-protein interaction studies:

    • Identify CrcB interaction partners involved in drug efflux or membrane maintenance

    • Use co-immunoprecipitation followed by mass spectrometry

    • Validate interactions with bacterial two-hybrid or FRET assays

  • Site-directed mutagenesis:

    • Target conserved residues predicted to be involved in ion transport

    • Assess effects on antibiotic resistance profiles

Given that S. sonnei is increasingly associated with antimicrobial resistance globally, understanding the potential contribution of CrcB to this phenotype is particularly relevant. The protein's predicted role in ion transport may influence membrane potential and subsequently affect the activity of various antimicrobial compounds .

How can CrcB homolog protein be incorporated into experimental vaccine designs against Shigella sonnei?

While CrcB homolog itself is not currently a primary vaccine target for Shigella sonnei, methodological approaches for incorporating it into experimental vaccine designs can be considered:

Antigen combination strategies:

  • Chimeric protein construction:

    • Design fusion proteins combining CrcB epitopes with established immunogens

    • Example approach: "Select residues 41-160 of IpaD, 21-89 of StxB, and specific regions of CrcB with optimal predicted epitopes, then connect with appropriate linkers (GGGS, GPGPG, KK, or EAAK)" based on successful chimeric protein designs

    • Evaluate physicochemical characteristics and immunogenic regions using bioinformatics tools

  • Multi-antigen vaccine formulations:

    • Include CrcB alongside established Shigella antigens (IpaB, IpaD, VirG)

    • The highly conserved nature of CrcB could potentially provide cross-protection against multiple Shigella species

    • VirG (IcsA) has shown promise as a cross-protective vaccine candidate due to its conservation across Shigella strains (>99% homology), suggesting a similar strategy could be viable for conserved proteins like CrcB

Epitope prediction and validation workflow:

  • Conduct in silico analysis to identify:

    • B-cell linear and conformational epitopes

    • MHC Class I and II binding epitopes (T-cell epitopes)

    • Regions with high predicted antigenicity

  • Synthesize selected peptide epitopes and validate immune recognition using:

    • ELISA with sera from convalescent patients

    • T-cell activation assays

  • Evaluate stability and structure:

    • Use Ramachandran plots to ensure >90% of amino acids are in favored regions

    • Assess instability and buried indices to optimize protein design

Expression and purification strategy:

For successful incorporation of CrcB into vaccine preparations:

  • Express in E. coli BL21 system with codon optimization (target CAI >0.9)

  • Purify using nickel chelating columns for His-tagged constructs

  • Ensure >95% purity and <20 endotoxin units/mg

  • Confirm identity via SDS-PAGE and Western blot

Immunogenicity assessment:

  • Measure serum IgG and IgM titers following administration

  • Evaluate functional antibody activity through serum bactericidal activity (SBA) assays

  • Assess T-cell responses via cytokine production and proliferation assays

The success of the GMMA (Generalized Modules for Membrane Antigens) vaccine approach for Shigella sonnei (1790GAHB) suggests that membrane proteins can be effective vaccine components when properly formulated .

Human Studies: DISCLAIMER: Please consult professional healthcare providers and adhere to all ethical guidelines, approvals, and informed consent requirements before conducting any research involving human subjects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.