Recombinant Shigella sonnei Protein psiE (psiE)

Basic Research Questions

• What is Shigella sonnei Protein psiE and what is its significance in research?

  Shigella sonnei Protein psiE (psiE) is a bacterial protein expressed by Shigella sonnei, a Gram-negative bacterium responsible for shigellosis, a form of bacillary dysentery. The protein is of significant research interest due to its potential role in Shigella pathogenesis. Research into psiE is particularly important because Shigella has been shown to have a stronger relationship to linear growth faltering (LGF) than many other enteropathogens, with higher bacterial loads resulting in greater growth deficits . Understanding psiE's function may contribute to developing more effective prevention strategies against Shigella infections, which are commonly detected in toddlers and young children but can cause more severe disease in infants .

• What are the molecular characteristics of psiE protein?

  Recombinant Shigella sonnei Protein psiE is characterized by:

  • Amino Acid Sequence: MTSLSRPRVEFISTILQTVLNLGLLCLGLILVVFLGKETVHLADVLFAPEQTSKYELVEGLIVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILLVITLWLCNSKRLKRE

  • Origin: Derived from Shigella sonnei (strain Ss046)

  • UniProt Accession Number: Q3YUV5

  • Protein Length: 136 amino acids (expression region 1-136)

  • Structural Features: Contains hydrophobic regions suggesting membrane association

  Researchers analyzing the sequence should note the presence of transmembrane domains and potential epitope regions that may be important for immunological studies.

• What are the recommended storage and handling practices for recombinant psiE?

  For optimal research outcomes, recombinant psiE requires specific storage and handling protocols:

  • Long-term Storage: Store at -20°C or -80°C for extended preservation

  • Working Conditions: Maintain working aliquots at 4°C for up to one week

  • Buffer Composition: Typically stored in Tris-based buffer with 50% glycerol optimized for protein stability

  • Freeze-Thaw Cycles: Repeated freezing and thawing is not recommended as it may lead to protein degradation or loss of activity

  Researchers should validate protein integrity after storage using appropriate analytical methods such as SDS-PAGE or Western blotting before experimental use.

• What experimental systems are suitable for studying psiE function?

  Several experimental systems can be employed to study psiE function:

  Experimental System	Application	Advantages	Limitations
  In vitro cell culture	Host-pathogen interactions	Controlled environment, easier manipulation	May not fully recapitulate in vivo conditions
  BALB/c mice models	Immunological studies	Well-established immune response model	Species differences from human responses
  Bioinformatic analysis	Structural predictions, epitope mapping	Non-invasive, hypothesis generating	Requires experimental validation
  ELISA-based assays	Protein-protein interactions, antibody binding	Quantitative, high sensitivity	Limited to interactions that can be detected by available antibodies

  Animal models, particularly BALB/c mice, have been successfully used for immunization studies against Shigella sonnei using multiepitope protein vaccine constructs .

• How can researchers verify the identity and purity of recombinant psiE?

  Verification of recombinant psiE identity and purity should involve multiple complementary approaches:

  1. Mass Spectrometry: For accurate molecular weight determination and sequence verification

  2. SDS-PAGE: To assess purity and approximate molecular weight

  3. Western Blotting: Using specific antibodies to confirm protein identity

  4. N-terminal Sequencing: To verify the first 5-10 amino acids match the expected sequence

  5. Functional Assays: To confirm biological activity is consistent with predicted function

  Researchers should establish acceptance criteria for purity (typically >90%) and identity confirmation before proceeding with experimental work.

Advanced Research Questions

• How can researchers address contradictory findings in psiE research?

  Contradictory findings in psiE research can be methodically addressed through:

  1. Systematic Review Approach: Compile all available data on psiE using standardized inclusion criteria

  2. Statistical Meta-analysis: When sufficient quantitative data is available

  3. Contradiction Detection Methodologies: Apply clinical contradiction detection approaches as demonstrated in medical literature analysis

  4. Context-Dependent Analysis: Examine experimental conditions, strains, and methodologies that might explain divergent results

  5. Replication Studies: Design experiments specifically to test contradictory findings under identical conditions

  Recent advances in clinical contradiction detection using distant supervision approaches and deep learning models can be particularly useful for analyzing conflicting statements in medical literature about psiE function . This approach leverages medical ontologies to build potential clinical contradictions over millions of medical abstracts and can help researchers systematically evaluate contradictory claims.

• What methodologies are recommended for studying psiE in relation to environmental enteric dysfunction (EED)?

  For investigating psiE's role in environmental enteric dysfunction:

  1. Case-Control Studies: Compare psiE expression or antibody responses in subjects with and without EED

  2. Longitudinal Cohort Studies: Monitor psiE presence/abundance over time in relation to EED biomarkers

  3. Integrated Multi-omics Approach: Combine proteomics, transcriptomics, and metabolomics to understand psiE's role in EED pathogenesis

  4. Biomarker Correlation Analysis: Analyze relationships between psiE detection and established EED biomarkers

  5. Intestinal Organoid Models: To study psiE effects on epithelial barrier function in controlled systems

  Research has shown that Shigella often has a stronger relationship to linear growth faltering than other enteropathogens, with asymptomatic cases also potentially contributing to stunting . Investigators studying psiE should consider these findings when designing experiments to explore its potential contribution to EED mechanisms.

• What bioinformatic approaches are most effective for predicting psiE epitopes for vaccine development?

  Effective bioinformatic approaches for psiE epitope prediction include:

  1. Sequence-Based Prediction: Algorithms that analyze primary sequence for potential B-cell and T-cell epitopes

  2. Structural Epitope Mapping: Based on 3D protein structure predictions

  3. Conservation Analysis: Identifying conserved regions across Shigella strains

  4. Immunogenicity Prediction: Algorithms estimating epitope binding to MHC molecules

  5. Epitope Cluster Analysis: Identifying regions with multiple overlapping epitopes

  Recent research has employed bioinformatic approaches to design multiepitope protein vaccines (MEPV) against Shigella species by identifying highly immunogenic epitopes . This methodology can be applied specifically to psiE to identify promising epitopes for vaccine development.

• How can researchers optimize expression systems for producing functional recombinant psiE?

  Optimization of expression systems for functional psiE requires:

  1. Vector Selection: Choosing appropriate expression vectors (e.g., pET-14b has been used for Shigella vaccine constructs)

  2. Codon Optimization: Adapting codons for the expression host (e.g., E. coli optimization)

  3. Expression Host Selection: Evaluating different strains for optimal expression

  4. Induction Conditions: Optimizing temperature, inducer concentration, and duration

  5. Purification Strategy Development: Based on protein characteristics

  Optimization Parameter	Variables to Test	Potential Impact
  Induction temperature	16°C, 25°C, 37°C	Folding efficiency, solubility
  IPTG concentration	0.1-1.0 mM	Expression level, toxicity
  Expression duration	3h, 6h, overnight	Yield vs. degradation
  Cell lysis method	Sonication, chemical, enzymatic	Protein integrity
  Purification tags	His-tag, GST, MBP	Solubility, purification efficiency

  Researchers should conduct small-scale optimization experiments before scaling up production.

• What are the most promising approaches for incorporating psiE in Shigella vaccine development?

  Promising approaches for incorporating psiE in vaccine development include:

  1. Multiepitope Vaccine Constructs: Combining immunogenic epitopes from psiE with other Shigella antigens

  2. Adjuvant Formulation: Testing different adjuvants to enhance immune response to psiE

  3. Delivery System Development: Evaluating various delivery platforms (liposomes, nanoparticles, viral vectors)

  4. Prime-Boost Strategies: Combining different vaccine types in sequential administration

  5. Mucosal Immunity Targeting: Developing formulations that induce strong mucosal immune responses

  Research with BALB/c mice has shown promise for immunization against Shigella sonnei using multiepitope protein vaccine constructs composed of highly immunogenic epitopes from Shigella pathogenic species . These approaches could be adapted specifically for psiE-based vaccine components.

• How can researchers assess the role of psiE in Shigella pathogenesis?

  To assess psiE's role in pathogenesis, researchers should consider:

  1. Gene Knockout Studies: Creating psiE-deficient mutants to observe virulence changes

  2. Complementation Assays: Restoring psiE function in mutants to confirm phenotype

  3. In Vivo Infection Models: Using animal models to assess virulence differences

  4. Transcriptional Analysis: Examining psiE expression patterns during infection

  5. Host Response Evaluation: Analyzing immune responses to wild-type vs. psiE-deficient strains

  Understanding psiE's contribution to pathogenesis is critical as Shigella infections are associated with significant health impacts, including linear growth faltering in children .

• What advanced analytical techniques are recommended for studying psiE protein-protein interactions?

  Advanced techniques for studying psiE interactions include:

  1. Co-immunoprecipitation (Co-IP): For identifying protein complexes containing psiE

  2. Yeast Two-Hybrid (Y2H): For screening potential interaction partners

  3. Surface Plasmon Resonance (SPR): For quantifying binding kinetics

  4. Proximity Ligation Assay (PLA): For visualizing interactions in situ

  5. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): For mapping interaction interfaces

  6. Cryo-Electron Microscopy: For structural analysis of psiE complexes

  These techniques can help elucidate psiE's functional interactions with both bacterial and host proteins, providing insights into its role in Shigella pathogenesis.