Recombinant Shigella sonnei Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant GlpG is typically produced using heterologous expression systems, with protocols optimized for stability and activity:

ParameterDetails
Expression SystemE. coli, yeast, or mammalian cells
TagHis-tag or GST-tag (varies by vendor)
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C
Purity>90% (confirmed via SDS-PAGE)

Substrate Specificity and Catalytic Mechanism

GlpG cleaves orphan membrane proteins with destabilized TMDs, such as:

  • HybA and HybO (hydrogenase-2 subunits) .

  • FdoH (formate dehydrogenase-O subunit) .

Key mechanistic findings:

  • Rate-driven cleavage: Substrate affinity is less critical than conformational flexibility .

  • Inhibitor sensitivity: Inhibited by 3,4-dichloroisocoumarin (DCI), a serine protease inhibitor, confirming its catalytic dyad dependency .

  • Helix-destabilizing residues: Proline in TMDs (e.g., HybA P300) facilitates substrate recognition .

Biological Role in Shigella

  • Quality control: Cleaves misfolded components of respiratory complexes, preventing toxic accumulation .

  • Phenotypic neutrality: Deletion of glpG and rhom7 in S. sonnei does not affect growth, oxidative stress resistance, or virulence under tested conditions .

Applications in Research

  • Enzymatic studies: Used to dissect rhomboid protease mechanisms via crystallography and kinetic assays .

  • Vaccine development: Explored as a potential antigen due to its conserved role in Shigella pathogenesis .

  • Membrane protein dynamics: Serves as a model for studying intramembrane proteolysis in prokaryotes .

Comparative Analysis with Other Rhomboids

FeatureS. sonnei GlpGE. coli GlpGRothia mucilaginosa Rhomboids
SubstratesHybA, FdoH, FdnH TatA, MgtE Collagen-associated proteins
Operon StructureIndependent gene Part of glpEGR operon Bicistronic operon
Protease ActivitySerine-dependent, liposome-embedded Similar to S. sonnei Requires proteoliposomes for activity

Challenges and Future Directions

  • Substrate identification: Only HybA, FdoH, and FdnH are confirmed substrates; broader profiling is needed .

  • Therapeutic targeting: Potential for antibiotic development, though GlpG’s phenotypic neutrality complicates this .

  • Structural dynamics: How GlpG accommodates diverse substrates remains unclear .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, kindly indicate them during order placement. We will fulfill your needs accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. For precise delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
glpG; SSON_3661; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
glpG
Target Protein Sequence
MLMITSFANPRVAQAFVDYMATQGVILTIQQHNQSDVWLADESQAERVRAELARFLENPA DPRYLAASWQAGHTGSGLHYRRYPFFAALRERAGPVTWVMMIACVVVFIAMQILGDQEVM LWLAWPFDPALKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLGSGKLIVITLI SALLSGYVQQKFSGPWFGGLSGVVYALMGYVWLRGERDPQSGIYLQRGLIIFALIWIVAG WFDLFGMSMANGAHIAGLAVGLAMAFVDSLNARKRK
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella sonnei rhomboid protease GlpG?

Shigella sonnei rhomboid protease GlpG (EC 3.4.21.105) is an intramembrane serine protease that functions in membrane protein quality control. It specifically targets orphan components of protein complexes, particularly those from respiratory complexes. GlpG in S. sonnei shares 99% amino acid identity with the prototypical rhomboid of Escherichia coli, making it a valuable model for studying rhomboid protease function . The protein consists of multiple transmembrane domains and contains a catalytic dyad (Ser201/His254) embedded approximately 10 Å below the membrane surface .

What are the known substrates of S. sonnei GlpG?

Studies have identified several substrates of S. sonnei GlpG. The primary natural substrates include HybA and HybO (subunits of the hydrogenase-2 complex), FdoH (a subunit of the formate dehydrogenase O complex), and YqjD (a ribosome-associated protein) . Additionally, artificial substrates containing the transmembrane domain of Providencia stuartii TatA have been used experimentally to study GlpG activity .

How does GlpG function in bacterial cells?

GlpG functions as a quality control mechanism in bacterial membranes by recognizing and cleaving orphan protein components that fail to incorporate into their respective multiprotein complexes. This initial proteolytic event marks these proteins for subsequent degradation, thereby protecting the cell from potential harmful effects of accumulated orphan membrane proteins . The protease specifically targets transmembrane domains (TMDs) with certain structural characteristics, and its activity is inhibited when the substrate is properly incorporated into a functional complex .

What structural features of GlpG contribute to its catalytic mechanism?

The crystal structure of GlpG in complex with diisopropyl fluorophosphonate (DFP) at 2.3 Å resolution has provided significant insights into its catalytic mechanism . The structure reveals:

  • A catalytic dyad (Ser201/His254) embedded approximately 10 Å below the membrane surface

  • Conformational changes within the active site upon substrate binding

  • A model for the tetrahedral transitional state during catalysis

The table below summarizes key crystallographic data for the GlpG-DFP complex:

ParameterGlpG-DFP Complex
Cell dimensions (Å)a = b = 109.7, c = 125.1
Resolution (Å)40.0–2.3 (2.38–2.30)
Observed reflections130,991
Unique reflections12,996
Redundancy10.1
R work/R free0.219/0.238
Number of protein atoms1373
Number of DFP atoms10
Number of water molecules43

GlpG utilizes a rate-driven proteolytic process, with substrate affinity playing a less important role in the reaction mechanism . The enzyme forms an initial "interrogation complex" with its substrate before proceeding to catalysis .

How do GlpG and Rhom7 differentially regulate substrate specificity?

S. sonnei possesses two active rhomboid proteases: GlpG and Rhom7. While they share some common substrates (like HybA), they also demonstrate distinct substrate preferences . GlpG cleaves HybA, HybO, FdoH, and YqjD, whereas Rhom7 cleaves HybA and FdnH .

This differential substrate recognition appears to involve:

  • Specific recognition of structural features within the transmembrane domains

  • Contextual factors related to the orientation and presentation of the substrate

  • Potential differences in the active site architecture between the two proteases

Research using artificial substrates with various transmembrane domains has helped identify the determinants for this specificity, revealing that rhomboid proteases preferentially target single-pass membrane proteins with a periplasmic N-terminus and a cytosolic C-terminus .

What experimental approaches can detect GlpG-mediated proteolysis in vivo?

Several methodological approaches have been developed to detect and quantify GlpG activity:

  • Western blot analysis with epitope-tagged substrates: Artificial substrates containing domains such as maltose-binding protein (MBP), 3xFLAG tags, transmembrane domains, and thioredoxin can be expressed in cells and cleavage products detected via immunoblotting .

  • Comparative analysis of active vs. inactive GlpG: Comparing wild-type GlpG with catalytically inactive mutants (e.g., GlpG S201A) allows specific attribution of cleavage products to GlpG activity .

  • Mass spectrometry-based approaches: These can be used to identify cleavage sites and natural substrates in complex cellular environments.

  • In vitro reconstitution systems: Purified components can be used to study the biochemical parameters of GlpG activity under defined conditions.

How do cellular conditions affect GlpG activity and substrate recognition?

The activity and substrate specificity of GlpG are influenced by various cellular conditions:

  • Respiratory status: Since GlpG targets components of respiratory complexes, the cell's respiratory state affects substrate availability and processing .

  • Membrane composition: The lipid environment likely influences GlpG activity, as it is an intramembrane protease whose active site is embedded within the membrane.

  • Redox conditions: While direct evidence for GlpG regulation by oxidative stress is lacking (tests with hydrogen peroxide and paraquat showed no significant differences between wild-type and knockout strains), the cellular redox state might indirectly affect substrate recognition or processing .

  • Growth conditions: Different growth conditions (aerobic vs. anaerobic) might affect the expression and assembly of respiratory complexes, thereby influencing the pool of potential GlpG substrates .

What are the optimal conditions for expressing and purifying recombinant S. sonnei GlpG?

Recombinant S. sonnei GlpG can be expressed and purified using established protocols:

  • Expression systems: E. coli expression systems are commonly used due to the high sequence similarity between E. coli and S. sonnei GlpG proteins.

  • Storage conditions: Optimal storage involves:

    • Temperature: -20°C for short-term or -80°C for extended storage

    • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

    • Working aliquots can be stored at 4°C for up to one week

  • Purification considerations:

    • Membrane protein extraction requires detergents

    • Affinity tags may be added to facilitate purification

    • Repeated freezing and thawing should be avoided to maintain activity

What assays can be used to measure GlpG activity in vitro?

Several in vitro assays have been developed to measure GlpG activity:

  • Fluorogenic peptide substrates: Peptides containing fluorescence resonance energy transfer (FRET) pairs that change emission upon cleavage.

  • Reconstituted membrane systems: Proteoliposomes containing GlpG and fluorescently labeled substrates.

  • Crystallographic approaches: As demonstrated with the GlpG-DFP complex, structural studies provide insights into interaction mechanisms and can be used with various inhibitors or substrate mimics .

  • Mass spectrometry: Can identify cleavage products and quantify reaction kinetics.

How can mutational analysis be used to study GlpG function?

Mutational analysis has been instrumental in understanding GlpG function:

  • Catalytic site mutations: Substitutions of key residues in the catalytic dyad (e.g., S201A) can create inactive enzymes for control experiments .

  • Transmembrane domain alterations: Modifications to the TMDs can provide insights into how the enzyme recognizes and positions substrates.

  • Loop region modifications: Changes to connecting loops can alter accessibility to the active site and substrate binding.

  • Chimeric constructs: Exchanging domains between different rhomboid proteases can help identify regions responsible for substrate specificity.

What are the considerations for designing artificial substrates to study GlpG?

Designing effective artificial substrates for GlpG studies requires attention to several factors:

  • Transmembrane domain selection: Natural substrates or well-characterized TMDs like that of P. stuartii TatA (amino acids 1-50) have proven effective .

  • Detection tags: Incorporation of epitope tags (e.g., 3xFLAG) facilitates detection of cleavage products .

  • Fusion partners: Domains like maltose-binding protein (MBP) and thioredoxin (Trx) can improve expression and solubility .

  • Expression level control: Inducible promoters allow titration of substrate levels to prevent overwhelming the cellular machinery.

How does the study of S. sonnei GlpG contribute to understanding broader rhomboid protease biology?

Research on S. sonnei GlpG provides insights into several aspects of rhomboid protease biology:

  • Evolutionary conservation: The high similarity between bacterial rhomboids suggests conserved mechanisms that may extend to eukaryotic systems .

  • Quality control mechanisms: The role of GlpG in eliminating orphan membrane proteins represents a fundamental cellular process likely present in various organisms .

  • Structural paradigms: The structural characterization of GlpG provides a template for understanding other rhomboid proteases .

  • Substrate recognition principles: Insights from GlpG substrate specificity inform our understanding of how intramembrane proteases select their targets .

What are the potential biotechnological applications of recombinant GlpG?

Recombinant GlpG has several potential biotechnological applications:

  • Tool for membrane protein engineering: GlpG can be used to selectively cleave membrane proteins in designed systems.

  • Biosensor development: Modified GlpG variants could detect specific membrane protein configurations.

  • Protein quality control in heterologous expression systems: Engineered GlpG systems might improve production of difficult membrane proteins.

  • Structural biology platform: GlpG serves as a model system for studying membrane protein structure and dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.