Recombinant Shigella sonnei Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
mdtI; SSON_1561; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
mdtI
Target Protein Sequence
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
Uniprot No.

Target Background

Function

Function: Catalyzes the excretion of spermidine.

Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein in Shigella sonnei and how does it function in polyamine transport?

MdtI is a membrane protein that functions as part of a spermidine excretion complex (MdtJI) in Shigella sonnei. It belongs to the small multidrug resistance (SMR) family of drug exporters. The protein works in conjunction with MdtJ to catalyze the excretion of spermidine from bacterial cells, which is crucial for maintaining polyamine homeostasis .

Studies in Escherichia coli, which shares significant genomic similarity with Shigella sonnei, have demonstrated that MdtJI functions as a hetero-oligomeric complex that specifically mediates spermidine efflux. This function is essential for preventing toxicity associated with spermidine overaccumulation in bacterial cells .

How does the MdtJI complex protect bacterial cells from polyamine toxicity?

The MdtJI complex plays a crucial role in protecting bacterial cells from the toxic effects of excessive polyamine accumulation, particularly spermidine. When bacterial cells are exposed to high concentrations of external spermidine (e.g., 2 mM), the compound accumulates intracellularly to potentially toxic levels. This accumulation can significantly reduce cell viability to less than 0.1% compared to cells cultured without spermidine .

Expression of the mdtJI gene in spermidine acetyltransferase-deficient strains (like E. coli CAG2242) increases cell viability over 1,000-fold when cultured in the presence of 2 mM spermidine. The complex functions by actively exporting accumulated spermidine from the cell, thereby reducing intracellular polyamine concentrations to non-toxic levels .

Table 1: Effect of MdtJI on E. coli Growth in High Spermidine Conditions

ConditionCell ViabilityIntracellular SpermidineSpermidine Excretion
Control (no mdtJI)<0.1%High accumulationMinimal
With mdtJI expression>1,000-fold increaseGreatly diminishedSignificant increase

Which critical amino acid residues are involved in MdtI functionality?

Several critical amino acid residues in MdtI are essential for its spermidine excretion activity. Research has identified the following key residues in MdtI that are involved in the protein's functionality :

  • Glu 5

  • Glu 19

  • Asp 60

  • Trp 68

  • Trp 81

These residues are likely involved in substrate recognition, binding, or the formation of the transport channel necessary for spermidine export. Functional studies have shown that mutations in these residues significantly impair the ability of the MdtJI complex to export spermidine and protect cells from polyamine toxicity .

Similarly, in the MdtJ protein, critical residues include Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82, which further emphasizes the importance of specific amino acid positions in the function of this transport complex .

How is mdtI gene expression regulated in response to environmental conditions?

The expression of the mdtI gene in Shigella sonnei is regulated in response to environmental conditions, particularly in response to polyamine levels. Research has demonstrated that mRNA levels of mdtJI increase in the presence of spermidine, suggesting a feedback regulatory mechanism .

This regulatory response allows bacterial cells to adaptively control the expression of spermidine export machinery based on cellular needs. When spermidine levels rise, the increased expression of mdtJI enhances the cell's capacity to export excess polyamines, thereby preventing toxicity .

The regulation of mdtI expression is likely part of a broader network controlling polyamine homeostasis in bacterial cells, which includes biosynthesis, degradation, uptake, and excretion pathways. This comprehensive regulatory system allows bacteria to maintain optimal intracellular polyamine concentrations under varying environmental conditions .

What methods can be used to induce and optimize recombinant MdtI expression?

For researchers working with recombinant MdtI, several methodological approaches can optimize expression:

Expression System Selection:

  • E. coli BL21(DE3) or derivatives are commonly used for membrane protein expression

  • Consider using C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Plasmid vectors with regulatable promoters (like pET or pBAD series) allow controlled expression

Optimization Parameters:

  • Induction conditions: Lower temperatures (16-25°C) often improve proper folding of membrane proteins

  • Inducer concentration: Titrate IPTG (0.1-1.0 mM) or arabinose (0.002-0.2%) to find optimal expression levels

  • Growth media: Specialized media like Terrific Broth or auto-induction media can enhance yields

  • Induction timing: Induce at mid-log phase (OD600 0.6-0.8) rather than early growth phases

Co-expression Strategies:
Since MdtI functions as a complex with MdtJ, co-expression of both proteins is essential for functional studies. This can be achieved through:

  • Dual-plasmid systems with compatible origins of replication

  • Bicistronic expression constructs containing both mdtI and mdtJ genes

  • Polycistronic vectors with multiple cloning sites

When co-expressing MdtJ and MdtI, it's crucial to verify that both proteins are being produced in appropriate stoichiometric ratios, as this affects complex formation and functionality .

What are the established methods for assessing MdtI-mediated spermidine export?

Researchers can employ several established methods to assess MdtI-mediated spermidine export:

1. Radioactive Transport Assays:

  • Preload cells with [14C]spermidine

  • Measure efflux of radioactivity from cells expressing MdtI/MdtJI versus control cells

  • Sample the extracellular medium at defined time points (e.g., 10, 20, 30, 40 minutes)

  • Analyze using liquid scintillation counting

2. HPLC-Based Polyamine Analysis:

  • Extract polyamines from cells and culture medium using acid or perchloric acid extraction

  • Derivatize polyamines for detection (commonly with dansyl chloride)

  • Separate and quantify using reverse-phase HPLC

  • Compare intracellular and extracellular polyamine levels between wild-type and mdtI mutants

3. Cell Viability Assays in Polyamine-Rich Conditions:

  • Culture bacterial cells (wild-type and mutants) in media with high spermidine concentrations

  • Assess viability through colony forming units (CFU) counting

  • Compare survival rates between cells expressing MdtJI and controls

4. Fluorescent Polyamine Analogs:

  • Use fluorescently labeled polyamine analogs to track transport in real-time

  • Monitor fluorescence changes using microscopy or plate reader platforms

  • Calculate transport kinetics based on fluorescence intensity changes

For example, in one study, researchers measured excretion of accumulated [14C]spermidine and observed significant export in cells transformed with pUC mdtJI but not in cells carrying an empty vector. After 40 minutes, the level of spermidine in the reaction mixture increased significantly when cells expressed the MdtJI complex, confirming its role in spermidine export .

How can researchers differentiate between MdtI-specific effects and other polyamine transport mechanisms?

Differentiating MdtI-specific effects from other polyamine transport mechanisms requires a systematic approach:

Genetic Approaches:

  • Generate precise gene deletions (ΔmdtI, ΔmdtJ, and ΔmdtIJ double mutants)

  • Construct complementation strains (reintroducing wild-type or mutated mdtI/mdtJ genes)

  • Create strains with inducible expression to control protein levels

  • Develop reporter fusions to monitor gene expression under different conditions

Biochemical Differentiation:

  • Substrate specificity profiling:

    • Test export of different polyamines (putrescine, spermidine, spermine, cadaverine)

    • Measure transport kinetics for each substrate

    • Determine if MdtI shows preferential activity for specific polyamines

  • Inhibitor studies:

    • Apply known inhibitors of alternative polyamine transporters

    • Assess if MdtI-mediated transport remains unaffected by these inhibitors

Experimental Controls:

  • Include strains deficient in other polyamine transporters

  • Test mutants lacking polyamine synthesis enzymes

  • Examine strains overexpressing competing polyamine transport systems

Research has shown that the MdtJI complex specifically catalyzes the excretion of spermidine but may have limited effect on other polyamines like putrescine. This specificity helps distinguish its role from other polyamine transport mechanisms. For example, measurements of polyamine content in E. coli CAG2242 showed that cells expressing MdtJI had specifically reduced spermidine accumulation while putrescine levels remained relatively unchanged .

What are the challenges in purifying functional MdtI protein for structural studies?

Purifying functional MdtI protein presents several significant challenges that researchers must address:

Membrane Protein Solubilization Challenges:

  • MdtI is a hydrophobic integral membrane protein requiring detergent solubilization

  • Selection of appropriate detergents is critical (commonly tested: DDM, LDAO, OG, LMNG)

  • Detergent concentration must be optimized to maintain protein stability without excess micelle formation

  • Mixed detergent systems may be necessary to preserve native-like conformations

Expression Limitations:

  • Overexpression often leads to misfolding and aggregation in inclusion bodies

  • Toxic effects on host cells when expressing membrane transporters

  • Low yields compared to soluble proteins (typically 0.1-1 mg/L culture)

  • Balancing expression levels to avoid aggregation while obtaining sufficient material

Purification Complexities:

  • Multi-step purification protocol typically required:

    • Affinity chromatography (His-tag, GST-tag)

    • Size exclusion chromatography

    • Ion exchange chromatography

  • Maintaining protein-detergent complexes throughout purification

  • Preventing oligomerization or aggregation during concentration

  • Assessing functional activity of purified protein

Stability Considerations:

  • Limited stability in detergent solutions

  • Temperature sensitivity during purification and storage

  • Requirement for specific lipids to maintain function

  • Buffer composition effects on stability (pH, salt concentration, additives)

Functional Verification:
Since MdtI functions in complex with MdtJ, purification strategies should consider co-purification of the complex rather than individual components to maintain functionality. Reconstitution into liposomes or nanodiscs may be necessary to verify transport activity of purified protein.

How conserved is the MdtI protein across different Shigella species and related Enterobacteriaceae?

The MdtI protein shows significant conservation across Shigella species and related members of the Enterobacteriaceae family, reflecting its important functional role in polyamine transport. Comparative genomic analyses reveal:

Conservation Patterns:

  • High sequence similarity (>90%) among MdtI proteins from different Shigella sonnei strains

  • Strong conservation across Shigella species (S. sonnei, S. flexneri, S. dysenteriae, S. boydii)

  • Close homology with MdtI in Escherichia coli, reflecting their close evolutionary relationship

  • Moderate conservation (60-80% sequence identity) with homologs in other Enterobacteriaceae genera such as Salmonella, Klebsiella, and Citrobacter

Functional Domain Conservation:
Critical amino acid residues involved in transport functionality, particularly Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81, show the highest conservation across species, indicating their essential roles in protein function .

Genomic Context Conservation:
The mdtJI gene cluster maintains a consistent arrangement across Enterobacteriaceae, with mdtJ and mdtI typically appearing as adjacent genes in an operon structure, further supporting their functional relationship as a complex .

The conservation of MdtI across bacterial species reflects the fundamental importance of polyamine homeostasis mechanisms in bacterial physiology and suggests evolutionary pressure to maintain this transport system.

What is the relationship between MdtI and other bacterial spermidine transport systems?

MdtI represents one component of a complex network of polyamine transport systems in bacteria. Understanding its relationship with other transport systems provides important context for research:

Distinct Classes of Bacterial Polyamine Transporters:

  • ABC Transporters:

    • PotABCD system: Primary spermidine/putrescine importer in many bacteria

    • Requires ATP for active transport into the cell

    • Functions opposite to MdtI (import vs. export)

  • Small Multidrug Resistance (SMR) Family:

    • MdtJI belongs to this family

    • Utilizes proton motive force rather than ATP

    • Primarily involved in export rather than import

    • Typically functions as heterodimers or heterooligomers

  • Spermidine-preferential uptake system (PuuP):

    • Dedicated to putrescine uptake in some bacteria

    • Different substrate specificity than MdtJI

Functional Complementarity:
The various polyamine transport systems work in concert to maintain polyamine homeostasis. While importers like PotABCD are responsible for acquiring polyamines from the environment under limiting conditions, exporters like MdtJI function to remove excess polyamines when they reach potentially toxic levels. This bidirectional transport capability allows bacteria to precisely regulate intracellular polyamine concentrations .

Regulatory Interactions:
Evidence suggests that different polyamine transport systems may be reciprocally regulated. For example, bacteria may downregulate importers while upregulating exporters under conditions of polyamine excess, and vice versa when polyamines are scarce.

How does MdtI function contribute to Shigella sonnei pathogenesis?

The MdtI protein's role in polyamine export has significant implications for Shigella sonnei pathogenesis through several mechanisms:

Adaptation to Host Environment:
During infection, Shigella sonnei encounters varying polyamine concentrations in different host niches. The bacteria's ability to modulate intracellular polyamine levels via MdtI-mediated export helps it adapt to these changing conditions. This adaptation is particularly important as Shigella navigates through the gastrointestinal tract and invades the colonic epithelium .

Polyamine-Dependent Virulence Expression:
Polyamines serve as important regulators of virulence gene expression in many bacterial pathogens. The MdtI-dependent regulation of intracellular polyamine levels may influence the expression of virulence factors needed for key pathogenic processes:

  • Invasion of epithelial cells

  • Intracellular survival and replication

  • Intercellular spread

  • Inflammatory response modulation

Survival During Stress Conditions:
Host environments expose Shigella to various stresses, including oxidative stress, acid stress, and antimicrobial peptides. Proper polyamine homeostasis, facilitated by MdtI, contributes to bacterial survival under these conditions by:

  • Protecting against oxidative damage

  • Maintaining membrane integrity

  • Supporting stress response gene expression

Competitive Advantage in the Gut Microenvironment:
Shigella sonnei competes with other gut microbes during infection. Studies suggest that S. sonnei has become increasingly prevalent globally, partly due to competitive advantages over other enteric pathogens . The ability to efficiently regulate polyamine levels through transporters like MdtI may contribute to this competitive advantage, similar to how S. sonnei uses the type VI secretion system (T6SS) to outcompete other Enterobacteriaceae species .

Could MdtI be targeted for antimicrobial development against multidrug-resistant Shigella?

MdtI represents a potentially valuable target for novel antimicrobial development against multidrug-resistant (MDR) Shigella sonnei strains:

Rationale for Targeting MdtI:

  • Essential Function: Disruption of polyamine export through MdtI inhibition could lead to toxic accumulation of polyamines within bacterial cells, significantly reducing viability .

  • Limited Host Homology: As a bacterial-specific transport system, inhibitors targeting MdtI would likely have minimal cross-reactivity with human polyamine transporters, potentially reducing side effects.

  • Addressing MDR Strains: The global increase in MDR Shigella sonnei strains (86% of strains in one study) necessitates new antimicrobial targets. MdtI offers a mechanism distinct from traditional antibiotic targets.

  • Potential Synergistic Effects: Inhibitors of MdtI could potentially sensitize bacteria to existing antibiotics by disrupting polyamine homeostasis, which plays roles in stress response and membrane integrity.

Drug Development Strategies:

  • Structure-Based Design:

    • Develop small molecule inhibitors targeting critical residues like Glu 5, Glu 19, and Asp 60 in MdtI

    • Design compounds that interfere with MdtI-MdtJ complex formation

  • Functional Inhibition Approaches:

    • Screen for compounds that block the transport channel

    • Develop polyamine analogs that compete for binding but resist transport

  • Regulatory Disruption:

    • Target transcriptional regulators of mdtI expression

    • Develop compounds that trigger excessive mdtI repression

Potential Challenges:

  • Redundancy in polyamine transport systems may limit efficacy

  • Membrane proteins are generally challenging drug targets

  • Complex interactions with polyamine metabolism pathways

  • Potential for rapid resistance development

Research on pathogenic Shigella sonnei has revealed that many strains already harbor multiple antibiotic resistance mechanisms, including mobile genetic elements, integrons, and resistance plasmids . The global spread of ciprofloxacin and fluoroquinolone-resistant S. sonnei has intensified the antimicrobial resistance burden , making novel targets like MdtI increasingly important for future therapeutic development.

How can CRISPR-Cas9 gene editing be applied to study MdtI function in Shigella sonnei?

CRISPR-Cas9 technology offers powerful approaches for investigating MdtI function in Shigella sonnei:

Precise Genetic Modifications:

  • Gene Knockout:

    • Create complete mdtI gene deletions to assess loss-of-function phenotypes

    • Design sgRNAs targeting conserved regions of the mdtI gene

    • Use homology-directed repair with selection markers for efficient isolation of mutants

    • Create marker-free deletions using dual-guide RNA approaches

  • Point Mutations:

    • Introduce specific amino acid substitutions at key residues (Glu 5, Glu 19, Asp 60, Trp 68, Trp 81)

    • Create a library of mutants with varied transport capabilities

    • Assess structure-function relationships with minimal disruption to protein structure

  • Regulatory Element Editing:

    • Modify promoter regions to alter expression levels

    • Create inducible or constitutive expression variants

    • Disrupt or enhance regulatory binding sites

Advanced Applications:

  • CRISPRi for Tunable Repression:

    • Deploy catalytically inactive Cas9 (dCas9) fused to repressor domains

    • Achieve graded knockdown rather than complete knockout

    • Study dose-dependent effects of MdtI expression

  • CRISPRa for Enhanced Expression:

    • Use dCas9 fused to activator domains to upregulate mdtI expression

    • Study consequences of MdtI overexpression on polyamine homeostasis

    • Assess potential growth advantages under specific conditions

  • Multiplex Editing:

    • Simultaneously target mdtI and related genes (mdtJ, polyamine biosynthesis)

    • Create double or triple mutants to assess genetic interactions

    • Investigate compensatory mechanisms when multiple pathways are disrupted

Protocol Considerations for Shigella sonnei:

  • Optimize transformation efficiency for plasmid delivery

  • Consider bacteriophage-based delivery systems if transformation is inefficient

  • Adjust homology arm lengths (typically 500-1000 bp) for efficient recombination

  • Implement counter-selection strategies to isolate marker-free mutants

  • Verify edits through sequencing and functional validation assays

What insights can proteomics approaches provide about MdtI interactions and regulatory networks?

Advanced proteomics approaches can reveal crucial insights into MdtI protein interactions and regulatory networks:

Interaction Mapping Techniques:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged MdtI protein (His-tag, FLAG-tag, etc.)

    • Perform gentle cell lysis preserving protein-protein interactions

    • Capture MdtI complexes via affinity chromatography

    • Identify interacting partners through mass spectrometry

    • Expected interactions: MdtJ, membrane complex assembly factors, regulatory proteins

  • Proximity-Based Labeling:

    • Fuse MdtI to BioID or APEX2 enzymes

    • Label proximal proteins in living cells

    • Identify the spatial interactome of MdtI in its native membrane environment

    • Map proteins in the vicinity of MdtI that may influence its function

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest and analyze crosslinked peptides

    • Determine specific interaction sites between MdtI and partners

    • Map structural relationships within the MdtJI complex

Quantitative Proteomic Applications:

  • Differential Expression Analysis:

    • Compare proteome changes in wild-type vs. ΔmdtI strains

    • Identify proteins with altered abundance in response to polyamine stress

    • Map compensatory mechanisms activated when MdtI is absent

  • Post-Translational Modification (PTM) Profiling:

    • Identify phosphorylation, acetylation, or other PTMs on MdtI

    • Determine how PTMs affect transport activity

    • Map signaling networks controlling MdtI function

  • Temporal Dynamics:

    • Monitor proteome changes during polyamine stress response

    • Establish the sequence of events in adaptation to high polyamine levels

    • Identify early vs. late response proteins

Membrane Proteomics Considerations:

  • Use specialized extraction methods optimized for membrane proteins

  • Consider detergent phase partitioning to enrich membrane fractions

  • Apply native MS techniques to preserve membrane protein complexes

  • Implement targeted proteomics (PRM/MRM) for sensitive detection of low-abundance membrane components

The integration of these proteomic approaches with transcriptomic and metabolomic data can provide a systems-level understanding of how MdtI functions within the broader context of bacterial polyamine metabolism and stress response networks.

How do genetic variations in mdtI influence antimicrobial resistance profiles in clinical Shigella sonnei isolates?

The relationship between mdtI genetic variations and antimicrobial resistance in clinical Shigella sonnei isolates represents an important area for investigation:

Observed Genetic Variation Patterns:

Clinical isolates of Shigella sonnei show considerable genetic diversity, including variations in genes related to drug transport and resistance. While specific data on mdtI variants in clinical isolates is limited, research on related transporters suggests several potential mechanisms by which variations could influence resistance:

  • Mutations Affecting Transport Efficiency:

    • SNPs in critical residues could enhance efflux capabilities

    • Alterations in transmembrane domains might expand substrate range

    • Mutations affecting oligomerization could impact transport complex stability

  • Regulatory Region Variations:

    • Promoter mutations leading to overexpression

    • Alterations in transcription factor binding sites

    • Changes in translational efficiency through ribosome binding site modifications

Correlation with Resistance Phenotypes:

Studies on multidrug-resistant Shigella sonnei have identified several patterns of antimicrobial resistance that could potentially interact with MdtI function:

  • Co-localization with Resistance Elements:

    • MDR Shigella sonnei strains frequently carry mobile genetic elements like SRL PAI (Shigella Resistance Locus Pathogenicity Island)

    • These elements encode resistance to multiple antibiotics including ampicillin, streptomycin, chloramphenicol, and tetracycline

    • The genomic context of mdtI relative to these elements could influence its expression and function

  • Temporal Dynamics of Resistance:

    • Studies tracking Shigella sonnei over time (1995-2013) showed shifting patterns of resistance determinants

    • Different clones emerged with distinct resistance profiles, suggesting evolutionary dynamics that could affect transporters like MdtI

Table 2: Observed Resistance Phenotypes in Chilean S. sonnei Isolates (1995-2013)

Time PeriodPredominant Resistance PatternMDR RateSRL PAI PresenceIntegron Type
1995-1997Variable-40%Rare
2002-2004Variable-4%Rare
2008-2009AMP-CHL-TET-STR-SXT-TMP100%100%Class 1
2010-2011AMP-CHL-TET-STR-SXT-TMP-65%Class 1
2012-2013TET-STR-SXT-TMP-NAL-43%Class 2

(AMP: ampicillin, CHL: chloramphenicol, TET: tetracycline, STR: streptomycin, SXT: sulfamethoxazole/trimethoprim, TMP: trimethoprim, NAL: nalidixic acid)

Research Methodology for Investigating mdtI Variations:

  • Whole Genome Sequencing Analysis:

    • Sequence diverse clinical isolates with varying resistance profiles

    • Identify SNPs and structural variations in mdtI and regulatory regions

    • Correlate genetic variations with antibiotic susceptibility patterns

  • Functional Validation:

    • Create isogenic strains differing only in mdtI variants

    • Assess MIC changes for various antibiotics

    • Measure polyamine transport efficiency in different variants

  • Transcriptional Analysis:

    • Quantify mdtI expression levels across clinical isolates

    • Correlate expression with resistance phenotypes

    • Identify regulatory mutations affecting expression

Understanding the relationship between mdtI variations and resistance could provide valuable insights for both surveillance and therapeutic development against increasingly resistant Shigella sonnei strains.

What are the promising approaches for developing high-throughput screening assays to identify MdtI inhibitors?

Developing high-throughput screening (HTS) assays for MdtI inhibitors represents a promising approach for novel antimicrobial discovery. Several methodological strategies show particular potential:

Fluorescence-Based Transport Assays:

  • Fluorescent Polyamine Derivatives:

    • Synthesize fluorescently labeled spermidine analogs

    • Monitor accumulation or efflux in whole cells or membrane vesicles

    • Measure fluorescence changes in real-time using microplate readers

    • Optimize for 384 or 1536-well format for true high-throughput capacity

  • FRET-Based Interaction Disruption:

    • Create MdtI and MdtJ fusion constructs with compatible FRET pairs

    • Screen for compounds that disrupt protein-protein interaction

    • Measure changes in FRET efficiency in presence of test compounds

  • Membrane Potential-Sensitive Dyes:

    • Utilize dyes like DiSC3(5) to monitor membrane potential changes

    • MdtI transport is linked to proton motive force

    • Inhibition would alter transport-associated membrane potential changes

Viability-Based Approaches:

  • Polyamine Toxicity Rescue:

    • Utilize strain backgrounds sensitive to polyamine toxicity (e.g., speG-deficient)

    • Culture cells with toxic spermidine concentrations + test compounds

    • Measure growth inhibition as indicator of MdtI inhibition

    • Compatible with standard microplate-based growth measurements

  • Synthetic Lethality Screens:

    • Create strains with genetic backgrounds where MdtI inhibition would be lethal

    • Screen for compounds that specifically inhibit growth of these strains

    • Include control strains to eliminate general toxicity

Biochemical and Biophysical Approaches:

  • ATPase Activity Assays:

    • Measure energy-dependent transport activity in purified systems

    • Monitor ATP consumption rates using coupled enzyme assays

    • Adapt to colorimetric or luminescence readouts for HTS compatibility

  • Surface Plasmon Resonance:

    • Immobilize purified MdtI protein or derived peptides

    • Screen for direct binding of test compounds

    • Measure binding kinetics and affinity parameters

Assay Development Considerations:

  • Validation Controls:

    • Positive controls: Known transport inhibitors or genetic knockouts

    • Negative controls: Inactive analogs or vehicle-only treatments

    • Internal standards for assay quality metrics (Z-factor, signal-to-background ratio)

  • Counter-Screening Strategy:

    • Secondary assays to confirm specificity for MdtI vs. other transporters

    • Cytotoxicity assessments against mammalian cells

    • Specificity panels against related bacterial transporters

  • Miniaturization and Automation:

    • Optimize reagent volumes for 384/1536-well formats

    • Implement robotic liquid handling systems

    • Develop data analysis pipelines for rapid hit identification

These HTS approaches provide a methodological foundation for identifying novel MdtI inhibitors that could lead to new therapeutic options against multidrug-resistant Shigella sonnei infections.

How might MdtI function differently in biofilm formation versus planktonic growth states?

The function of MdtI likely differs substantially between planktonic and biofilm growth states, with important implications for bacterial physiology and pathogenesis:

Polyamine Dynamics in Biofilms:

  • Altered Microenvironment:

    • Biofilms create distinct chemical gradients

    • Limited diffusion may lead to polyamine accumulation in specific regions

    • Local pH variations could affect MdtI transport efficiency

  • Metabolic Shifts:

    • Biofilm cells often exist in altered metabolic states

    • Changes in energy availability may impact MdtI-mediated transport

    • Altered polyamine biosynthesis rates in biofilm vs. planktonic cells

  • Spatial Organization:

    • MdtI expression may vary between different biofilm regions

    • Polyamine concentration gradients could develop within biofilm structure

    • Cells in different biofilm layers may have different transport requirements

Gene Expression and Regulation:

  • Differential Expression Patterns:

    • Transcriptomic studies in related bacteria show altered expression of transport systems in biofilms

    • MdtI expression likely responds to biofilm-specific signals

    • Integration with biofilm regulatory networks (e.g., c-di-GMP signaling)

  • Stress Response Coordination:

    • Biofilms frequently upregulate stress response systems

    • Polyamine transport may be coordinated with other stress responses

    • MdtI function might contribute to biofilm-associated stress tolerance

Methodological Approaches for Investigation:

  • Spatial Transcriptomics:

    • Use laser capture microdissection to isolate cells from different biofilm regions

    • Analyze region-specific expression of mdtI and related genes

    • Map expression patterns to biofilm architecture

  • Fluorescent Reporters:

    • Construct mdtI promoter-GFP fusions

    • Visualize expression dynamics during biofilm formation

    • Use confocal microscopy for 3D expression mapping

  • Polyamine Distribution Analysis:

    • Develop methods to visualize polyamine distribution in biofilms

    • Use chemical probes or antibodies against specific polyamines

    • Correlate distribution with MdtI expression patterns

  • Genetic Approaches:

    • Create mdtI deletion mutants and assess biofilm formation capacity

    • Develop conditional expression systems to modulate MdtI during specific biofilm stages

    • Investigate genetic interactions with known biofilm regulators

Understanding the role of MdtI in biofilm formation could reveal new insights into bacterial adaptation mechanisms and potentially identify novel approaches for disrupting biofilm-associated infections caused by Shigella sonnei.

What is the potential role of MdtI in bacterial interactions with bacteriophages?

The relationship between MdtI function and bacteriophage interactions represents an unexplored frontier in bacterial physiology research:

Potential Mechanisms of Interaction:

Research Questions to Explore:

  • Phage Resistance Correlation:

    • Do mdtI mutants show altered susceptibility to specific phages?

    • Is there correlation between polyamine export activity and phage resistance?

    • Can manipulation of MdtI expression alter phage infection dynamics?

  • Infection-Induced Expression Changes:

    • Does phage infection alter mdtI expression?

    • Are there temporal patterns to this regulation during infection?

    • Do different phages elicit different responses?

  • Evolutionary Implications:

    • Is there evidence for co-evolution between phage infection strategies and bacterial polyamine transport?

    • Do laboratory evolution experiments under phage pressure select for mdtI variants?

Experimental Approaches:

  • Phage Susceptibility Testing:

    • Compare plaque formation efficiency between wild-type and mdtI mutants

    • Measure adsorption rates and burst sizes

    • Assess phage resistance development under different polyamine conditions

  • Transcriptional Analysis:

    • Monitor mdtI expression changes during phage infection

    • Use RNA-seq to map global transcriptional responses

    • Compare multiple phage types to identify common vs. specific responses

  • Evolutionary Experiments:

    • Subject bacterial populations to phage pressure over many generations

    • Sequence evolved populations to identify mdtI mutations

    • Characterize changes in polyamine transport phenotypes

This research direction could reveal unexpected roles for MdtI in phage defense and potentially identify new applications in phage therapy or biocontrol strategies against Shigella sonnei infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.