Recombinant Shigella sonnei Spermidine export protein MdtJ (mdtJ)

What is the Spermidine export protein MdtJ and its primary function in Shigella?

MdtJ is a 121-amino acid protein that forms part of the MdtJI efflux pump complex in Shigella. This complex belongs to the small multidrug resistance (SMR) family of transporters and functions primarily in polyamine transport, particularly spermidine efflux. MdtJ contains four transmembrane segments with most functional amino acid residues facing the cytoplasm, similar to other polyamine excretion proteins like PotE and CadB . The protein plays a critical role in regulating intracellular polyamine levels, which directly impacts Shigella's virulence and survival within host cells. The full amino acid sequence of MdtJ from Shigella sonnei (strain Ss046) is: MYIYWILLGLAIAITGTLSMKWASVSEGGFIMLVMISLSYIFLSFAVKKIALGVAYALWEGIGILFITLFSVLLFDESLSLMKIAGLTTLVAGIVLIKSGTRKARKPELEVNHGAV .

How does polyamine metabolism in Shigella differ from that in E. coli?

The polyamine profile of Shigella differs markedly from its ancestor E. coli through pathoadaptive mutations that contribute to Shigella's virulence. Key differences include:

These differences result from convergent evolution processes and contribute significantly to Shigella's virulence and adaptation to the host environment .

What is the genetic organization of the mdtJI operon?

The mdtJI operon encodes two protein components: MdtJ (121 amino acids) and MdtI (109 amino acids), which together form the functional efflux pump. In Shigella sonnei strain Ss046, the mdtJ gene is annotated as SSON_1560 . The operon contains a promoter region that has been identified through primer extension analysis and is subject to regulation by multiple factors, including the nucleoid protein H-NS . Under physiological conditions, the operon is expressed at very low levels in E. coli but shows differential expression in Shigella due to various regulatory mechanisms .

What factors regulate mdtJI expression in Shigella compared to E. coli?

The mdtJI operon is regulated by multiple factors in Shigella, with significant differences compared to E. coli:

In E. coli, the mdtJI operon is primarily silenced by H-NS, while in Shigella, the combination of high spermidine levels and the presence of VirF counteracts this repression. This differential regulation reflects Shigella's adaptation to the host environment and its pathogenic lifestyle .

How does the MdtJI complex contribute to Shigella pathogenicity?

The MdtJI complex plays a significant role in Shigella pathogenicity through polyamine homeostasis regulation. Specifically:

• The complex functions as a "safety valve" allowing Shigella to maintain optimal spermidine levels for survival within infected macrophages while preventing toxicity from over-accumulation .

• By promoting the excretion of putrescine (the spermidine precursor), MdtJI helps maintain the polyamine balance favorable for virulence expression .

• The increased expression of mdtJI in response to bile components suggests its importance during intestinal colonization and infection .

• The coordinated regulation with other virulence factors (through VirF) indicates integration of polyamine transport into the broader virulence program of Shigella .

This polyamine homeostasis regulation is particularly important since Shigella lacks spermidine acetyltransferase (SAT), which normally converts spermidine to its inert form in E. coli .

What is the relationship between MdtJI, antibiotic resistance, and multidrug resistance in Shigella?

While MdtJI primarily functions as a polyamine transporter, its membership in the small multidrug resistance (SMR) family of exporters suggests potential roles in antibiotic resistance. Although direct evidence connecting MdtJI to specific antibiotic resistance in Shigella is limited in the provided sources, multidrug resistance is a critical issue in Shigella clinical isolates:

• Clinical isolates of Shigella from China showed 100% multidrug resistance rates, with varying resistance to cefotaxime (36.67%), ciprofloxacin (21.67%), and azithromycin (10.00%) .

• Multiple resistance genes and mechanisms contribute to this phenotype, including extended-spectrum beta-lactamase (ESBL) production found in 23.33% of isolates .

• The resistance profiles differ between Shigella flexneri and Shigella sonnei for certain antimicrobials .

The potential contribution of efflux pumps like MdtJI to this resistance profile represents an area requiring further investigation, especially considering that SMR family transporters can export various compounds besides their primary substrates.

How do bile components influence mdtJI expression and function?

Bile components have been found to stimulate mdtJI expression in Shigella . This finding has significant implications:

• Experimental assays have demonstrated increased mdtJI expression in response to deoxycholate (2.5 and 5 mg/ml) and bile salts (6 and 9 mg/ml) .

• This upregulation suggests that MdtJI function is particularly important in the intestinal environment where Shigella encounters bile.

• The bile-responsive regulation may coordinate polyamine transport with intestinal colonization and infection progression.

• This environmental responsiveness represents another layer of regulation beyond the genetic factors (H-NS, VirF) and metabolic factors (spermidine levels) already identified .

The precise mechanism by which bile components signal to increase mdtJI expression remains an area for further research, potentially involving specific bile-responsive transcription factors or indirect effects through membrane perturbation.

What techniques can be used to study mdtJI gene expression?

Several complementary techniques have been employed to study mdtJI expression:

• Primer Extension Analysis: Used to identify the mdtJI promoter region and transcription start site .

• In vivo Transcription Assays: Employed to measure expression levels under different genetic backgrounds and environmental conditions .

• Gel-Retardation Experiments: Used to demonstrate direct binding of regulatory proteins (such as H-NS) to the mdtJI regulatory region .

• Gene Fusion Constructs: Plasmids containing mdtJI promoter fusions to reporter genes have been constructed to monitor expression in different conditions .

• Genetic Approaches: Comparing expression in wild-type strains versus mutants lacking specific regulators (e.g., H-NS, VirF) to understand regulatory networks .

These methods, used in combination, provide comprehensive insights into the complex regulation of the mdtJI operon in different bacterial backgrounds and environmental conditions.

How can researchers generate and confirm mdtJI deletion mutants?

The generation of mdtJI deletion mutants is critical for functional studies. The process typically follows these steps:

• One-step Gene Inactivation Method: Using the approach described for M90T JId strain, researchers can transform bacteria containing the pKD46 plasmid with amplicons obtained using plasmid pKD13 as template and specific oligonucleotide pairs .

• PCR Verification: Following recombination, candidate mutants are verified by PCR using primers flanking the deleted region.

• Functional Confirmation: Polyamine transport assays can be performed to confirm the loss of MdtJI function.

• Complementation Testing: Reintroducing the mdtJI operon on a plasmid (such as pULS88) into the deletion mutant should restore the wild-type phenotype, confirming the specificity of the observed effects .

The M90T JId strain described in the literature, carrying a deletion of the mdtJI operon, was constructed using this approach with the oligo pair JIdF/JIdR and showed no difference in growth rate compared to the wild-type M90T under standard laboratory conditions .

What methods are appropriate for studying polyamine transport by MdtJI?

To assess polyamine transport mediated by MdtJI, researchers can employ several approaches:

• Putrescine Excretion Assays: MdtJI has been shown to promote putrescine excretion in polyamine-free media, providing a functional readout of transporter activity .

• Spermidine Accumulation Measurements: Comparing intracellular spermidine levels between wild-type and mdtJI mutants can reveal the contribution of this transporter to polyamine homeostasis.

• Radioactively Labeled Polyamine Flux Studies: Using labeled polyamines to track influx/efflux rates in cells expressing or lacking MdtJI.

• Reconstitution in Proteoliposomes: Purified MdtJI can be reconstituted into artificial membrane systems to directly measure transport activities.

• Growth Assays in Toxic Polyamine Conditions: Comparing survival of strains with and without functional MdtJI when exposed to high polyamine concentrations.

The choice of method depends on the specific research question and available resources, with combinations of approaches providing the most comprehensive understanding of MdtJI transport function.

How can recombinant MdtJ protein be produced and purified for structural and functional studies?

Production of recombinant MdtJ protein involves several key considerations:

• Expression Systems: Recombinant MdtJ can be produced using various expression systems, with commercial preparations available as described in source .

• Storage Conditions: The purified protein is typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week .

• Stability Considerations: Repeated freezing and thawing should be avoided to maintain protein integrity .

• Tagging Strategy: The tag type can be determined during the production process based on the specific experimental requirements .

• Expression Region: For Shigella sonnei MdtJ, the full expression region corresponds to amino acids 1-121 .

For membrane proteins like MdtJ, special considerations include the use of appropriate detergents during purification and potential reconstitution into membrane-mimetic environments for functional studies.

What are the key unanswered questions about MdtJ/MdtJI function in Shigella?

Several important questions remain to be fully addressed:

• Structural Basis of Transport: While MdtJ is known to have four transmembrane segments, detailed structural information about the functional MdtJI complex and its transport mechanism remains limited.

• Substrate Specificity: Beyond spermidine and putrescine, the full range of substrates that can be transported by MdtJI and potential differences in substrate preference between Shigella and E. coli variants need further investigation.

• Integration with Virulence Pathways: The precise mechanisms linking polyamine transport to virulence gene expression and the full extent of VirF's role in regulating mdtJI require additional study .

• Environmental Sensing: How environmental signals like bile components are detected and transmitted to influence mdtJI expression remains an open question .

• Evolution of Regulation: Understanding how the differential regulation of mdtJI between Shigella and E. coli evolved would provide insights into bacterial adaptation during the evolution of pathogenicity.

Addressing these questions will require multidisciplinary approaches combining genetics, biochemistry, structural biology, and infection models.

How might MdtJ research contribute to novel antimicrobial strategies?

Research on MdtJ and the MdtJI complex could inform new antimicrobial strategies through several avenues:

• Targeting Polyamine Homeostasis: Given the importance of polyamine balance for Shigella survival in macrophages, compounds disrupting this balance could reduce bacterial persistence during infection .

• Efflux Pump Inhibitors: Developing specific inhibitors of MdtJI function could potentially increase bacterial susceptibility to antibiotics or disrupt virulence.

• Anti-virulence Approaches: By understanding how polyamine transport contributes to virulence regulation, new strategies targeting virulence rather than bacterial growth could be developed.

• Diagnostic Applications: Knowledge of MdtJ/MdtJI expression patterns could contribute to developing molecular diagnostics for Shigella detection or antibiotic resistance prediction.

• Vaccine Development: Recombinant MdtJ protein could potentially serve as a component in multi-target vaccine strategies against Shigella.

The high rate of multidrug resistance in clinical Shigella isolates (100% in some studies ) underscores the urgent need for novel therapeutic approaches beyond conventional antibiotics.