Recombinant Shigella sonnei Thiol:disulfide interchange protein DsbD (dsbD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Important: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you have a particular tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
dsbD; SSON_4319; Thiol:disulfide interchange protein DsbD; Protein-disulfide reductase; Disulfide reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-565
Protein Length
Full Length of Mature Protein
Species
Shigella sonnei (strain Ss046)
Target Names
dsbD
Target Protein Sequence
GLFDAPGRSHFVPADQAFAFDFQQNQHDLNLTWQIKDGYYLYRKQIRITPEHAKIADVQL PQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQGCADAGFCYPPETKTVPLS EVVANNAASQPVSVPQQEQHTAQLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQ RLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQHPYVLIGLAIVFTLLAMSM FGLFTLQLPSSLQTHLTLMSNRQQGGSPGGVFVMGAIAGLICSPCTTAPLSAILLYIAQS GNMWLGGGMLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQVKTAFGFVILALPIFLLER VIGDIWGLRLWSALGVAFFGWAFITSLQAKRGWMRVVQIILLAAALVSVRPLQDWAFGAT HTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWCVACKKFEKYTFSDPQVQKA LADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAH LRDRQP
Uniprot No.

Target Background

Function
This protein is essential for the proper formation of disulfide bonds in some periplasmic proteins and for the assembly of periplasmic c-type cytochromes. It facilitates electron transfer from cytoplasmic thioredoxin to the periplasm. This transfer involves a series of disulfide bond formation and reduction steps.
Database Links
Protein Families
Thioredoxin family, DsbD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Shigella sonnei DsbD protein?

Shigella sonnei DsbD functions as a thiol:disulfide interchange protein (EC 1.8.1.8) in the bacterial periplasm. Its primary role involves facilitating electron transfer during oxidative protein folding. Unlike DsbA, which has been shown to be directly involved in virulence, DsbD mutation does not significantly affect virulence compared to wild-type Shigella . The protein likely functions in maintaining other disulfide isomerases in their active reduced state, supporting the proper folding of various bacterial proteins including potential virulence factors.

How does DsbD differ functionally from other Dsb proteins in Shigella pathogenesis?

Experimental evidence shows distinct roles for different Dsb proteins in Shigella pathogenicity:

  • DsbA: Inactivation significantly reduces virulence in gentamicin protection assays and Serény tests, indicating its critical role in pathogenicity

  • DsbC: Mutation shows virulence patterns similar to wild-type, suggesting a non-essential role in primary virulence mechanisms

  • DsbD: Inactivation (dsbD-kan mutants) does not substantially alter virulence compared to wild-type strains

This differentiation suggests DsbD likely functions in maintaining the redox state of other disulfide isomerases rather than directly catalyzing the folding of essential virulence factors.

What methodologies are recommended for studying DsbD's role in bacterial protein folding machinery?

Several methodological approaches should be considered:

  • Genetic manipulation techniques: Construction of dsbD knockout mutants using targeted gene inactivation (e.g., dsbD-kan constructs) followed by complementation with wild-type gene to verify phenotypes

  • Protein interaction studies: Identify DsbD substrates and redox partners through pull-down assays, bacterial two-hybrid systems, or crosslinking experiments

  • Functional assays: Measure disulfide bond formation/isomerization rates in wild-type versus dsbD mutant backgrounds

  • Expression analysis: Monitor expression of dsbD under various environmental conditions relevant to infection (pH, temperature, oxidative stress)

  • Virulence assessment: Compare wild-type and dsbD mutant strains using:

    • In vitro cell invasion assays (gentamicin protection assays)

    • In vivo virulence models (Serény test)

    • Secretion/folding analysis of known virulence factors

How should researchers design experiments to investigate differences between DsbD function in S. sonnei versus S. flexneri?

A comprehensive experimental design should include:

  • Creation of isogenic dsbD mutants in both species using identical methodologies

  • Complementation studies with heterologous dsbD genes (sonnei dsbD in flexneri mutant and vice versa)

  • Comparative analysis of:

    • Growth rates under oxidative stress conditions

    • Virulence in standardized invasion assays

    • Secretion profiles of virulence factors

    • Host immune responses to each mutant

  • Structural and biochemical comparison of purified DsbD proteins from both species

  • Transcriptomic/proteomic analysis of the disulfide proteome in both wild-type and mutant strains

Control experiments must include wild-type strains and complemented mutants to confirm phenotypic changes are specifically due to DsbD function.

What are the technical challenges in purifying functional recombinant DsbD protein?

Purification of active recombinant DsbD presents several challenges:

  • Membrane integration: As DsbD contains transmembrane domains, solubilization requires careful detergent optimization

  • Redox sensitivity: Maintaining the correct oxidation state during purification requires controlled redox conditions

  • Domain organization: The multi-domain nature of DsbD complicates expression of the full-length functional protein

  • Storage considerations: Commercial preparations recommend storage in "Tris-based buffer with 50% glycerol" at -20°C for short-term or -80°C for extended storage

  • Stability issues: "Repeated freezing and thawing is not recommended" for maintaining activity

  • Expression systems: Selection of appropriate host strains lacking endogenous Dsb proteins that might interfere with proper folding

How can researchers evaluate DsbD's role in Shigella vaccine development?

While DsbD itself may not be directly involved in vaccine formulations, its study has implications for vaccine development:

  • Protein folding impact: As demonstrated in virulence studies, Dsb proteins affect proper folding of bacterial antigens that may be vaccine targets

  • Live attenuated vaccine considerations: Modification of dsbD could potentially be explored as an attenuation strategy, though current evidence suggests dsbA mutation may be more effective

  • Antigen production: Understanding DsbD's role in protein folding can improve production of properly folded recombinant antigens for subunit vaccines

  • Immune response assessment: Researchers should evaluate how DsbD function affects the expression of immunogenic surface proteins by comparing:

    • IgA antibody-secreting cell responses to wild-type versus dsb mutants

    • Serum antibody responses (IgG and IgA) to specific antigens

    • Cytokine production profiles, particularly IFN-γ responses that have been observed in Shigella vaccine studies

What techniques should be used to study the electron transfer pathway of DsbD?

To elucidate the electron transfer mechanisms:

  • Site-directed mutagenesis: Systematic mutation of cysteine residues to identify those essential for electron transfer

  • Redox potential measurements: Determine the standard redox potential of DsbD and its domains

  • Electron transfer kinetics: Measure rates of electron transfer between DsbD and potential partner proteins

  • Structural studies: X-ray crystallography or cryo-EM to visualize conformational changes during the catalytic cycle

  • In vivo redox state analysis: Trapping and analyzing the in vivo redox states of DsbD using acid quenching and alkylation techniques

How does environmental context affect DsbD function during Shigella infection?

Researchers should consider various environmental factors when studying DsbD:

  • pH dependence: Activity should be assessed across pH ranges encountered during infection (intestinal pH ~6-8)

  • Temperature effects: Compare activity at environmental temperatures versus host body temperature (37°C)

  • Oxidative stress response: Evaluate function under conditions mimicking host-generated reactive oxygen species

  • Nutrient limitation: Study expression and activity under iron-limited conditions (relevant as Shigella vaccines like WRSS1 have been studied for aerobactin encoding gene iuc mutations)

  • Host cell compartmentalization: Consider differential function in various cellular compartments (vacuolar versus cytosolic)

What immunological markers should be monitored when evaluating DsbD's indirect impact on vaccine efficacy?

Based on established Shigella immunological studies, researchers should monitor:

  • Antibody responses:

    • IgA antibody-secreting cells (ASCs) recognizing Shigella lipopolysaccharide (LPS)

    • Serum antibodies (IgG and IgA) to LPS and invasion plasmid antigens (Ipa)

    • Fecal IgA titers

  • Cellular immune responses:

    • Proliferative responses of peripheral blood mononuclear cells (PBMC) to Shigella antigens

    • Cytokine production, particularly IFN-γ and IL-10, in response to Shigella antigens

    • T-cell responses to proteins potentially affected by DsbD function

The following table summarizes key immunological parameters measured in Shigella vaccine studies that could be applied to DsbD research:

Immune ParameterMeasurement MethodTypical Sampling TimeSignificance
IgA ASCsELISPOTDays 7 and 10 post-vaccinationEarly mucosal immune response indicator
Serum IgGELISADays 7, 14, 21, and 28 post-vaccinationSystemic humoral immunity
Serum IgAELISADays 7, 14, 21, and 28 post-vaccinationMucosal immunity precursor
Fecal IgAELISADays 3, 7, 10, and 14 post-vaccinationDirect mucosal immunity indicator
IFN-γ productionPBMC stimulationDay 28 post-vaccinationType 1 cell-mediated response
IL-10 productionPBMC stimulationDay 28 post-vaccinationRegulatory response

How can contradictions in DsbD function data be reconciled between in vitro and in vivo studies?

When facing contradictory results, researchers should:

  • Standardize experimental conditions:

    • Use consistent bacterial growth phases

    • Control for media composition effects

    • Standardize host cell types for in vitro studies

  • Validate with multiple methodologies:

    • Complement genetic studies with biochemical approaches

    • Use both in vitro cell culture and in vivo animal models

    • Perform complementation studies to confirm specificity of observed effects

  • Consider redundancy in disulfide bond formation pathways:

    • Investigate potential compensatory mechanisms in dsbD mutants

    • Create and analyze double or triple dsb mutants

    • Examine species-specific variations in the Dsb system

  • Address technical variables:

    • Storage conditions affect protein stability ("repeated freezing and thawing is not recommended")

    • Expression systems may influence protein folding and activity

    • Detection methods vary in sensitivity (culture methods for WRSS1 have a detection limit of approximately 10³ CFU/g)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.