Recombinant Shigella sonnei Universal stress protein B (uspB)

What is Universal stress protein B (uspB) in Shigella sonnei?

Universal stress protein B (uspB) is a bacterial protein expressed by Shigella sonnei that belongs to the universal stress protein family, a conserved group of proteins that typically respond to various environmental stressors. In S. sonnei strain Ss046, uspB is encoded by the SSON_3729 locus and consists of 111 amino acids . The protein plays a role in the bacterial stress response system, likely helping the pathogen survive under adverse conditions encountered during infection or environmental exposure. The amino acid sequence (MISTVALFWALCVVCIVNMARYFSSLRALLVVLRNCDPLLYQYVDGGGFFTSHGQPNKQVRLVWYIYAQRYRDHHDDEFIRRCERVRRQFILTSALCGLVVVSLIALMIWH) suggests it contains hydrophobic regions that may be involved in membrane association or protein-protein interactions . While specific functions of uspB in S. sonnei remain less characterized than other virulence factors, its conservation across strains suggests biological significance.

How does Shigella sonnei uspB differ from uspB in other bacterial species?

While uspB is part of the universal stress protein family found across many bacterial species, S. sonnei uspB has distinctive features. The S. sonnei uspB (UniProt ID: Q3YW37) is 111 amino acids in length with a unique sequence profile that likely reflects evolutionary adaptations specific to the pathogen's niche . Compared to other bacterial stress proteins, S. sonnei uspB may have specialized functions related to survival during enteric infection or transmission.

The sequence conservation of uspB across different S. sonnei lineages is notable, especially considering the significant genomic diversity that has been identified through whole-genome sequencing of isolates collected over the past three decades . This conservation contrasts with the substantial genomic variation observed between different S. sonnei lineages, including the classical laboratory strain 53G (Lineage 2) and the currently dominant clinical isolates (primarily Lineage 3) . The methodological approach to studying these differences typically involves comparative genomics, recombinant protein expression, and functional assays that examine stress response under various conditions.

What are the optimal storage and handling conditions for recombinant S. sonnei uspB?

Recombinant S. sonnei uspB requires specific storage and handling protocols to maintain protein integrity and functionality. The protein should be stored in a Tris-based buffer containing 50% glycerol, which helps prevent protein denaturation and aggregation . For long-term storage, maintain the protein at -20°C or preferably at -80°C for extended stability .

When working with the protein, it's crucial to avoid repeated freeze-thaw cycles as these can significantly compromise protein structure and activity . Instead, prepare working aliquots that can be stored at 4°C for up to one week to minimize degradation . Before experimental use, gentle thawing on ice is recommended rather than rapid warming. The presence of 50% glycerol in the storage buffer requires consideration when designing experimental protocols, as this may affect protein concentration calculations or downstream applications. When handling the protein for functional studies, maintaining a consistent cold chain and minimizing exposure to proteases are essential methodological considerations.

How can we assess the functional role of uspB in S. sonnei virulence using human challenge models?

Investigating the functional role of uspB in S. sonnei virulence requires a methodical approach combining molecular techniques with human challenge models. First, researchers should develop isogenic mutant strains of S. sonnei with uspB gene deletions or modifications using CRISPR-Cas9 or allelic exchange methods. These mutants should be characterized for growth kinetics, stress response, and in vitro virulence phenotypes before proceeding to human studies.

For human challenge models, the established protocol using S. sonnei strain 53G can serve as a foundation, though researchers should consider using strains from the more clinically relevant Lineage 3 . Based on previous challenge studies, an inoculum of 1680 CFU administered after sodium bicarbonate buffer produced a 75% attack rate in healthy Thai adults, making this a suitable baseline for studying virulence factors . Lower doses (93 or 440 CFU) resulted in approximately 50% attack rates and may be more appropriate for detecting enhanced virulence in experimental strains .

The methodology should include:

• Controlled administration of wild-type and uspB mutant strains to separate volunteer cohorts

• Comprehensive monitoring of clinical outcomes, including incubation period, disease severity, and duration

• Measurement of bacterial shedding patterns through stool culture and PCR detection

• Assessment of host immune responses via antibody-secreting cells (ASC) assays and serum antibody titers against S. sonnei LPS

• Correlation of uspB expression levels (in recovered bacteria) with disease progression

When analyzing results, researchers should account for pre-existing immunity in study populations from endemic regions, as this may confound virulence assessments . IgA ASC responses have been shown to be more sensitive indicators of S. sonnei infection than other immunologic assays and should be prioritized in analysis .

What are the structural and functional relationships between uspB and other stress response proteins in S. sonnei?

Understanding the structural and functional relationships between uspB and other stress response proteins in S. sonnei requires an integrated structural biology and systems biology approach. The 111-amino acid uspB protein likely forms specific tertiary structures that mediate its function in stress response pathways .

Methodologically, researchers should first determine the three-dimensional structure of S. sonnei uspB using X-ray crystallography or cryo-electron microscopy. This structural data can then be compared with known structures of other universal stress proteins to identify conserved domains and potential interaction surfaces. Protein-protein interaction studies using techniques such as bacterial two-hybrid systems, co-immunoprecipitation followed by mass spectrometry, or proximity-dependent biotin labeling can identify uspB's interaction partners within the S. sonnei stress response network.

For functional analysis, researchers should employ:

• Transcriptomic profiling (RNA-seq) of wild-type and uspB-knockout strains under various stress conditions to identify co-regulated genes

• Phosphoproteomic analysis to determine if uspB participates in phosphorylation-dependent signaling cascades

• In vitro biochemical assays to test for enzymatic activities (e.g., ATPase, kinase, or chaperone functions)

• Comparative analysis across S. sonnei lineages to identify evolutionary selection pressures on uspB structure and function

The relationship between uspB and the broader bacterial stress response can be further elucidated by examining its expression patterns during various stages of infection and under different environmental stressors. This methodological framework allows researchers to position uspB within the complex regulatory networks that govern S. sonnei adaptation and virulence.

How can recombinant uspB be utilized in developing diagnostic tools for lineage-specific detection of S. sonnei?

Developing lineage-specific diagnostic tools using recombinant uspB requires a methodological approach that leverages both the conserved and variable regions of the protein across S. sonnei lineages. While the classical laboratory strain 53G belongs to the now-rare Lineage 2, most clinical isolates are from the dominant Lineage 3, creating a need for lineage-specific detection methods .

The methodological approach should include:

• Comparative sequence analysis of uspB across all S. sonnei lineages to identify conserved regions for general detection and variable regions for lineage discrimination

• Design and optimization of antibody-based detection systems:

  • Generate monoclonal antibodies against recombinant uspB that recognize lineage-specific epitopes

  • Develop ELISA systems using these antibodies for differential detection with sensitivity targets of <10³ CFU/ml

  • Implement lateral flow immunoassays for field-deployable diagnostics

• Nucleic acid-based detection methods:

  • Design PCR primers targeting uspB polymorphisms specific to each lineage

  • Develop multiplex qPCR assays that can simultaneously detect and differentiate S. sonnei lineages

  • Implement CRISPR-Cas12/13-based detection systems for enhanced sensitivity

• Validation methodologies:

  • Test against diverse clinical isolates with known genomic sequences

  • Determine limits of detection in various clinical matrices (stool, rectal swabs)

  • Assess cross-reactivity with other Shigella species and Enterobacteriaceae

  • Evaluate performance in populations with varying S. sonnei endemicity

For optimal sensitivity and specificity, a combination approach may be warranted, where uspB detection is paired with other lineage-specific markers identified through whole-genome sequencing studies . This is particularly important given the ongoing adaptive evolution observed in Lineage 3 strains, characterized by increased insertion sequence abundance, gene pseudogenisation, and genomic rearrangements .

What genomic changes affect uspB expression across different S. sonnei lineages?

The expression of uspB across different S. sonnei lineages may be influenced by various genomic changes that have occurred during the pathogen's evolution. Recent genomic analyses reveal significant differences between the historically used laboratory strain 53G (Lineage 2) and currently circulating clinical isolates (predominantly Lineage 3) .

A methodological approach to investigating these differences should include:

• Comparative promoter analysis:

  • Extract and compare the upstream regulatory regions of uspB from complete genome sequences of different lineages

  • Identify polymorphisms in promoter elements, transcription factor binding sites, and other regulatory sequences

  • Use reporter gene assays to quantify the impact of these variations on uspB expression levels

• Transcriptome profiling:

  • Perform RNA-sequencing on multiple isolates representing different lineages under standardized conditions

  • Quantify uspB transcript levels across lineages and correlate with genomic features

  • Analyze co-expression networks to identify lineage-specific regulatory patterns

• Epigenetic analysis:

  • Map DNA methylation patterns in the uspB locus across lineages using bisulfite sequencing

  • Correlate methylation status with gene expression levels

  • Investigate the impact of insertion sequences (IS), which are known to accumulate in Lineage 3 isolates , on uspB expression

• Integration with structural genomic changes:

  • Assess the impact of genomic rearrangements observed in Lineage 3 strains on uspB expression

  • Determine if gene pseudogenisation events in related stress response pathways affect uspB regulation

  • Evaluate copy number variations that might influence uspB dosage

This methodological framework can reveal how evolutionary forces have shaped uspB expression across S. sonnei lineages, potentially explaining differences in stress response capabilities and virulence between historical and contemporary isolates. Understanding these changes is crucial for developing accurate models of S. sonnei pathogenicity that reflect currently circulating strains rather than laboratory-adapted isolates.

How should experiments be designed to investigate uspB function in S. sonnei stress response?

Designing experiments to investigate uspB function in S. sonnei stress response requires a multi-faceted approach that integrates genetic manipulation, cellular physiology, and stress response assays. The methodological framework should follow these principles:

• Genetic manipulation strategy:

  • Generate precise uspB deletion mutants (ΔuspB) using allelic exchange or CRISPR-Cas9 systems

  • Create complemented strains by reintroducing uspB under native and inducible promoters

  • Develop strains with tagged uspB (e.g., His-tag, FLAG-tag) for protein localization and interaction studies

  • Construct point mutations in conserved residues to identify functionally critical amino acids

• Stress response characterization:

  • Subject wild-type and mutant strains to standardized stress conditions including:

    • Oxidative stress (H₂O₂, paraquat)

    • Nitrosative stress (NO donors)

    • Acid stress (pH gradients relevant to GI tract)

    • Bile salt exposure (relevant to intestinal environment)

    • Nutrient limitation

    • Temperature shifts

    • Antimicrobial peptides

  • Monitor survival rates, growth kinetics, and morphological changes under each condition

  • Measure gene expression changes in stress-response networks using RT-qPCR or RNA-seq

• Cellular physiology assessment:

  • Analyze changes in membrane potential and integrity

  • Measure intracellular ATP levels and energy charge

  • Quantify reactive oxygen species generation

  • Assess protein aggregation and stability under stress conditions

• In vitro infection models:

  • Evaluate bacterial invasion and replication in intestinal epithelial cell lines

  • Measure survival rates within macrophages

  • Assess responses to host-derived stressors

  • Compare results across S. sonnei lineages, particularly contrasting the laboratory strain 53G (Lineage 2) with clinical isolates from Lineage 3

• Data analysis methods:

  • Apply statistical analyses appropriate for each experimental design

  • Use principal component analysis to identify key stress variables affecting uspB function

  • Develop mathematical models of uspB-dependent stress responses

  • Integrate results with existing knowledge of universal stress proteins in related bacteria

This experimental framework provides a comprehensive approach to characterizing uspB function while accounting for the genomic diversity observed across S. sonnei lineages and the evolutionary adaptations that may influence stress response mechanisms.

What controls and validation steps are essential when working with recombinant S. sonnei uspB?

When working with recombinant S. sonnei uspB, implementing rigorous controls and validation steps is essential to ensure experimental reliability and reproducibility. A methodological approach should include:

• Protein quality validation:

  • Confirm protein purity using SDS-PAGE with Coomassie or silver staining (>95% purity recommended)

  • Verify protein identity via Western blot with anti-uspB antibodies or mass spectrometry

  • Assess protein folding through circular dichroism spectroscopy

  • Determine oligomerization state using size-exclusion chromatography

  • Validate tag accessibility (if present) using tag-specific antibodies or functional assays

• Activity and functional controls:

  • Include positive controls with known functional activity in all assays

  • Use denatured uspB as a negative control to distinguish specific from non-specific effects

  • Implement dose-response experiments to establish concentration-dependent effects

  • Validate protein activity immediately after thawing and at experimental endpoint

  • Include tag-only controls when working with tagged versions of the protein

• Storage and stability validation:

  • Monitor protein stability under storage conditions (-20°C or -80°C) over defined time periods

  • Assess activity retention after freeze-thaw cycles

  • Verify stability in working buffer conditions at 4°C for the duration of experiments

  • Quantify protein concentration before each experiment to account for potential losses

• Batch consistency checks:

  • Maintain reference samples from well-characterized batches

  • Perform batch-to-batch comparisons using standardized activity assays

  • Document production conditions, purification methods, and storage history

  • Implement quality control thresholds for accepting new protein batches

• Experimental system validation:

  • Include system suitability tests before each experimental run

  • Validate antibody specificity with appropriate blocking experiments

  • Confirm lack of interfering substances in experimental buffers

  • Ensure equipment calibration and performance verification

• Biological relevance controls:

  • Compare recombinant uspB activity with native protein when possible

  • Validate cellular uptake or interaction when using recombinant uspB in cell-based assays

  • Consider the impact of any modifications (tags, purification methods) on protein function

  • Verify that buffer components (e.g., 50% glycerol) don't interfere with experimental systems

These methodological controls and validation steps ensure that experimental findings with recombinant S. sonnei uspB are reliable and biologically relevant, particularly when studying a protein that may have lineage-specific variations and functions.

How should researchers interpret conflicting data on uspB function across different S. sonnei strains?

• Strain lineage analysis:

  • Determine the phylogenetic lineage of each strain used (Lineage 1, 2, or 3) through whole-genome sequencing or marker-based typing

  • Consider that the classical laboratory strain 53G (Lineage 2) is now rare in clinical settings, while most current isolates belong to Lineage 3

  • Evaluate whether functional differences correlate with lineage-specific genomic adaptations

  • Assess if insertion sequence accumulation or structural variations in Lineage 3 strains impact uspB function

• Methodological variation assessment:

  • Compare experimental protocols in detail (buffers, temperatures, pH, etc.)

  • Evaluate differences in protein preparation and storage that might affect activity

  • Standardize assay conditions where possible to eliminate technical variables

  • Consider the impact of different expression systems on protein folding and post-translational modifications

• Genomic context evaluation:

  • Analyze uspB sequence variations between strains, particularly in functional domains

  • Examine differences in uspB gene expression regulation across strains

  • Investigate potential interactions with strain-specific factors that might modify uspB function

  • Consider the impact of different plasmid profiles, especially the pINV invasion plasmid which is essential for virulence but frequently lost during laboratory culture

• Integrative data analysis:

  • Implement meta-analysis techniques to identify consistent trends across studies

  • Use statistical approaches that account for inter-strain variability

  • Develop mathematical models that incorporate strain-specific parameters

  • Consider Bayesian approaches to weigh evidence based on study quality and reproducibility

• Validation through comparative studies:

  • Design experiments with standardized conditions using multiple strains in parallel

  • Include reference strains with well-characterized uspB function

  • Employ complementation studies to verify the specific role of uspB variants

  • Test hypotheses generated from conflicting data on clinical isolates from different lineages

This methodological framework acknowledges that S. sonnei is undergoing ongoing adaptive evolution , with Lineage 3 displaying increased insertion sequence abundance and genomic rearrangements that may affect gene function. When interpreting conflicting data, researchers should consider that differences might reflect genuine biological variation rather than experimental error, particularly given the phylogenetic distance between the commonly used laboratory strain 53G and currently circulating clinical isolates.

What statistical approaches are most appropriate for analyzing uspB-related experimental data?

Selecting appropriate statistical approaches for analyzing uspB-related experimental data requires careful consideration of experimental design, data characteristics, and research questions. The following methodological framework outlines best practices:

• Descriptive statistics fundamentals:

  • Begin with comprehensive exploration of data distributions, including tests for normality

  • Calculate appropriate central tendency measures (mean, median) and dispersion metrics (standard deviation, interquartile range)

  • Generate visual representations including box plots for comparing uspB expression or activity across conditions

  • Assess data for outliers that may represent biological significance rather than experimental error

• Comparative analyses between experimental groups:

  • For normally distributed data with equal variances: Apply parametric tests (t-test for two groups, ANOVA for multiple groups)

  • For non-normally distributed data: Use non-parametric alternatives (Mann-Whitney U test, Kruskal-Wallis test)

  • When comparing wild-type vs. uspB mutant responses to multiple stressors: Implement two-way ANOVA with post-hoc tests

  • For time-course experiments (e.g., uspB expression during infection): Apply repeated measures ANOVA or mixed-effects models

• Correlation and regression approaches:

  • Assess relationships between uspB expression levels and phenotypic outcomes using correlation analyses

  • For predictive modeling of uspB contributions to stress response: Apply multiple regression techniques

  • When analyzing multiple interconnected variables: Consider partial least squares or principal component regression

  • For complex dose-response relationships: Employ non-linear regression models

• Advanced statistical methods for complex datasets:

  • For large-scale transcriptomic data: Implement differential expression analysis with appropriate multiple testing correction

  • When investigating protein interaction networks: Apply graph theory-based statistical approaches

  • For integrating genomic and functional data across lineages: Use hierarchical clustering and multidimensional scaling

  • When comparing responses across S. sonnei lineages: Consider phylogenetically aware statistical methods

• Sample size and power considerations:

  • Conduct a priori power analyses to determine required sample sizes

  • Report confidence intervals alongside p-values to indicate effect size precision

  • Consider biological vs. technical replication strategies based on experimental variability

  • Implement sequential analysis approaches when working with limited isolates or patient samples

• Reproducibility and validation practices:

  • Split datasets into discovery and validation cohorts when possible

  • Apply cross-validation techniques to prevent overfitting in predictive models

  • Use bootstrapping methods to assess result stability

  • Consider Bayesian approaches to incorporate prior knowledge about uspB function

When analyzing data from studies involving human challenge models with S. sonnei , particular attention should be paid to within-subject correlation structures and potential confounding factors such as pre-existing immunity. Similarly, when comparing different S. sonnei lineages , statistical approaches should account for phylogenetic relationships to differentiate lineage-specific effects from general trends in uspB function or expression.

How can understanding uspB function contribute to vaccine development against S. sonnei?

Understanding the function of Universal stress protein B (uspB) in Shigella sonnei can significantly contribute to vaccine development strategies through several methodological pathways. The approach should consider both the basic immunological principles and the practical aspects of vaccine design:

• Antigen selection and validation:

  • Evaluate uspB as a potential vaccine antigen based on:

    • Conservation across S. sonnei lineages, particularly between the laboratory strain 53G (Lineage 2) and currently dominant clinical isolates (Lineage 3)

    • Surface accessibility during infection

    • Expression levels during different stages of pathogenesis

    • Immunogenicity in natural infection

  • Test recombinant uspB formulations for:

    • Antibody response quality and quantity

    • T-cell epitope presentation and recognition

    • Cross-protection against multiple S. sonnei lineages

• Vaccine platform selection:

  • Assess uspB incorporation into various vaccine platforms:

    • Subunit vaccines using purified recombinant uspB

    • Live-attenuated S. sonnei strains with enhanced uspB expression

    • Viral vector vaccines expressing uspB

    • mRNA vaccines encoding uspB

    • DNA vaccines with optimized uspB sequences

• Adjuvant and delivery optimization:

  • Test uspB-based vaccines with different adjuvants to enhance immunogenicity

  • Evaluate mucosal delivery systems to target intestinal immunity

  • Optimize antigen presentation by manipulating uspB structure or formulation

  • Develop thermostable formulations for use in resource-limited settings

• Preclinical validation methodology:

  • Implement animal models to assess:

    • Immunogenicity (antibody titers, T-cell responses)

    • Protection against challenge

    • Safety profile and reactogenicity

  • Use in vitro assays to measure:

    • Neutralizing antibody function

    • Antibody-dependent cellular cytotoxicity

    • Complement-mediated killing

• Human challenge model integration:

  • Design vaccine efficacy studies using the established human challenge model for S. sonnei

  • Target challenge dose of 1680 CFU for 75% attack rate in control groups

  • Utilize sensitive immunological markers such as IgA antibody-secreting cells (ASC) as correlates of protection

  • Account for pre-existing immunity in endemic populations

The translational pathway should acknowledge that most current vaccine development work uses the laboratory strain 53G, which belongs to the now-rare Lineage 2, while most clinical isolates belong to Lineage 3 . Therefore, uspB-based vaccine strategies should be evaluated against phylogenetically diverse S. sonnei isolates to ensure broad protection against currently circulating strains. Additionally, the methodology should consider the ongoing adaptive evolution observed in Lineage 3, characterized by increased insertion sequence abundance, gene pseudogenisation, and genomic rearrangements , which might affect uspB expression or function.

What are the methodological considerations for targeting uspB in antimicrobial drug development?

Targeting Universal stress protein B (uspB) in antimicrobial drug development against Shigella sonnei requires a systematic methodological approach that addresses both the scientific and practical aspects of drug discovery. The following framework outlines key considerations:

• Target validation methodology:

  • Confirm essentiality or significant contribution of uspB to:

    • Bacterial survival under stress conditions relevant to infection

    • Virulence in cellular and animal infection models

    • Persistence in host tissues

  • Validate druggability through:

    • Structural analysis of potential binding pockets

    • Assessment of functional domains amenable to small molecule inhibition

    • Comparison with successful targeting of related proteins in other pathogens

• High-throughput screening approach:

  • Develop robust biochemical assays measuring:

    • Direct uspB activity (if enzymatic function is identified)

    • Protein-protein interactions critical for uspB function

    • Conformational changes upon ligand binding

  • Implement cell-based screening systems:

    • Reporter strains reflecting uspB function or expression

    • Phenotypic screens measuring stress response

    • Survival assays under conditions where uspB is critical

• Structure-based drug design methodology:

  • Determine high-resolution structure of S. sonnei uspB using:

    • X-ray crystallography

    • Cryo-electron microscopy

    • NMR spectroscopy for dynamic regions

  • Employ in silico approaches:

    • Molecular docking to identify potential binding molecules

    • Virtual screening of compound libraries

    • Fragment-based design starting with low-complexity molecules

• Lead optimization framework:

  • Establish structure-activity relationships through:

    • Medicinal chemistry campaigns

    • Quantitative structure-activity relationship (QSAR) modeling

    • Iterative synthesis and testing cycles

  • Evaluate compound properties including:

    • Spectrum of activity across S. sonnei lineages

    • Selectivity over human proteins

    • Physicochemical and ADME properties

    • Resistance development potential

• Resistance mitigation strategy:

  • Assess genetic barriers to resistance:

    • Frequency of spontaneous mutations conferring resistance

    • Fitness costs of resistance-conferring mutations

    • Alternative pathways that might compensate for uspB inhibition

  • Design combination approaches:

    • Dual-targeting compounds affecting uspB and other targets

    • Combination therapy strategies

    • Collateral sensitivity relationships

• Translational considerations:

  • Evaluate effectiveness against diverse clinical isolates:

    • Testing against both laboratory strain 53G (Lineage 2) and currently dominant Lineage 3 isolates

    • Assessment of activity against isolates with varying antimicrobial resistance profiles

  • Develop appropriate delivery strategies:

    • Formulations suitable for enteric infections

    • Consideration of biofilm penetration

    • Strategies to reach intracellular bacteria

This methodological framework acknowledges the genomic diversity within S. sonnei populations and ensures that drug development efforts target conserved aspects of uspB function while accounting for potential lineage-specific variations. Special attention should be given to the translational gap between laboratory studies (often using strain 53G) and clinical applications targeting currently circulating strains from Lineage 3.