Recombinant Shigella sonnei UPF0059 membrane protein yebN (yebN)

How is recombinant Shigella sonnei UPF0059 membrane protein yebN typically expressed and purified for research applications?

Expression and purification of recombinant yebN protein requires specialized methodologies due to its membrane-associated nature. The recommended approach follows these steps:

• Vector Selection: Use expression vectors containing strong inducible promoters suitable for membrane protein expression

• Host Selection: E. coli strains specifically designed for membrane protein expression (such as C41, C43, or Lemo21) are preferred

• Growth Conditions: Culture at lower temperatures (16-25°C) after induction to slow protein synthesis and facilitate proper folding

• Extraction: Membrane protein extraction using detergents (commonly n-dodecyl-β-D-maltoside or LDAO)

• Purification: Affinity chromatography using appropriate tags determined during the production process, followed by size exclusion chromatography

The purification process typically yields approximately 100 milligrams of membrane-associated proteins per liter of fermentation when optimized growth conditions are maintained with optical densities of 30-45 in a 5L fermenter system . Researchers should note that the tag type will be determined during the production process based on optimal expression conditions for this specific membrane protein .

What are the recommended storage conditions for recombinant yebN protein to maintain stability and activity?

Maintaining the structural integrity and functional activity of recombinant yebN protein requires specific storage conditions. The protein should be stored in a Tris-based buffer supplemented with 50% glycerol, which has been optimized specifically for this protein .

Long-term storage recommendations include:

• Primary storage at -20°C

• Extended storage at -20°C or -80°C

• Avoiding repeated freeze-thaw cycles, which can significantly degrade membrane protein integrity

• Preparing working aliquots that can be stored at 4°C for up to one week

These storage recommendations are based on empirical observations of membrane protein stability and are similar to those used for other Shigella membrane proteins such as yohJ, suggesting a generalizable approach for this class of proteins .

How can recombinant Shigella sonnei UPF0059 membrane protein yebN be utilized in vaccine development research?

Recombinant yebN protein has significant potential in vaccine development research as part of broader outer membrane protein (OMP) vaccine strategies. The methodological approach involves:

• Incorporation of yebN into Outer Membrane Particles (OMPs): yebN can be included in genetically derived outer membrane particles that consist of outer membrane lipids, proteins, and soluble periplasmic components .

• Genetic Modification Approaches: Research can employ genetic manipulations to optimize immunogenicity, including:

  • Deletion of specific genes (e.g., ΔtolR ΔgalU) to increase particle shedding

  • Abolition of O antigen synthesis to modify immunogenicity

  • Modification of lipopolysaccharide structure to reduce reactogenicity

• Immunogenicity Assessment: Purified particles containing yebN have been shown to be highly immunogenic in mouse models, suggesting potential vaccine applications .

• Production Scalability: High-density cultivation of bacteria for outer membrane particles yields approximately 100 mg of membrane-associated proteins per liter, indicating feasibility for scaled manufacturing processes .

This approach aligns with the Generalized Modules of Membrane Antigens (GMMA) strategy for vaccine production from Gram-negative bacteria, offering advantages in terms of immunogenicity and manufacturing scalability .

What structural and functional analyses can be performed to characterize recombinant yebN protein interactions with other cellular components?

Comprehensive characterization of yebN protein interactions requires multiple complementary analytical approaches:

• Structural Analysis Techniques:

  • X-ray crystallography with appropriate detergents or lipidic cubic phase crystallization

  • Cryo-electron microscopy for visualization in near-native membrane environments

  • NMR spectroscopy for dynamics studies (challenging for full-length membrane proteins)

• Functional Interaction Studies:

  • Co-immunoprecipitation assays with potential binding partners

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Cross-linking mass spectrometry to capture transient interactions

  • Isothermal titration calorimetry for binding kinetics

• Membrane Integration Analysis:

  • Protease protection assays to determine topology

  • Fluorescence resonance energy transfer (FRET) to measure proximity to other membrane components

  • Site-directed spin labeling combined with electron paramagnetic resonance

The hydrophobic regions and transmembrane domains identified in the yebN sequence (MNITATVLLAFGMSMDAFAASVGKGATLHKPKFSEALRTGLIFGAVETLTPLIGWGMGML ASRFVLEWNHWIAFVLLIFLGGRMIIEGFRGADDEDEEPRRRHGFWLLVTTAIATSLDAM AVGVGLAFLQVNIIATALAIGCATLIMSTLGMMVGRFIGSIIGKKAEILGGLVLIGIGVQ ILWTHFHG) provide starting points for predicting protein-lipid and protein-protein interaction interfaces .

What are the critical considerations when designing site-directed mutagenesis experiments to study yebN protein function?

Site-directed mutagenesis provides powerful insights into structure-function relationships of yebN protein. The methodological approach should include:

• Target Selection Strategy:

  • Conserved residues identified through multiple sequence alignments with homologous proteins

  • Predicted functional domains based on the 188-amino acid sequence

  • Transmembrane regions that may be involved in substrate transport or signaling

• Mutation Design Considerations:

When designing mutations, researchers should pay particular attention to the hydrophobic regions and transmembrane domains identified in the sequence analysis, as these are likely critical for proper membrane integration and function .

How does yebN protein compare structurally and functionally with other membrane proteins in Shigella sonnei?

Comparative analysis of yebN with other Shigella sonnei membrane proteins reveals important structural and functional insights:

• Structural Comparison:

  • yebN (188 amino acids) is classified as a UPF0059 membrane protein with predicted transmembrane regions

  • In comparison, the UPF0299 membrane protein yohJ (132 amino acids) shows a different structural organization while maintaining membrane localization

  • Both proteins contain hydrophobic transmembrane segments, but sequence analysis suggests different topological arrangements

• Functional Context:

  • yebN belongs to a family of uncharacterized membrane proteins (UPF0059) whose precise functions remain to be fully elucidated

  • Other characterized Shigella membrane proteins like yegS (a probable lipid kinase) have more defined enzymatic activities

  • The membrane localization of these proteins suggests potential roles in bacterial-host interactions, virulence, or transport functions

• Comparative Analysis Methodology:

  • Sequence alignment using BLAST or MUSCLE to identify conserved domains

  • Hydropathy profile analysis to compare transmembrane region distribution

  • Structural prediction using algorithms specifically optimized for membrane proteins

  • Phylogenetic analysis to determine evolutionary relationships

This comparative approach provides context for understanding yebN's potential roles within the broader membrane protein landscape of Shigella sonnei.

What proteomic approaches can be employed to study yebN protein expression under different environmental conditions?

Studying yebN expression under varying environmental conditions requires sophisticated proteomic methodologies:

• Sample Preparation Techniques:

  • Bacterial culture under defined stress conditions (pH, temperature, nutrient limitation)

  • Membrane fractionation using differential centrifugation

  • Protein extraction with specialized detergents optimized for membrane proteins

• Quantitative Proteomic Methods:

• Data Analysis Approach:

  • Normalization to account for membrane protein extraction variability

  • Statistical analysis to identify significant expression changes

  • Pathway analysis to contextualize expression changes

  • Correlation with transcriptomic data when available

• Validation Methods:

  • Western blotting with specific antibodies

  • Targeted mass spectrometry using multiple reaction monitoring

  • Fluorescent protein fusions to monitor localization and expression

This proteomic workflow can reveal how yebN expression responds to environmental cues relevant to Shigella pathogenesis, potentially providing insights into its functional significance .

How can high-throughput screening methodologies be applied to identify small molecule modulators of yebN protein function?

Developing high-throughput screening (HTS) approaches for yebN protein requires specialized methodologies due to its membrane nature:

• Assay Development Strategy:

  • Fluorescence-based transport assays if yebN functions as a transporter

  • Cell-based reporter systems linking yebN activity to detectable signals

  • Thermal shift assays adapted for membrane proteins to detect ligand binding

  • Surface plasmon resonance with immobilized yebN in nanodiscs or liposomes

• Compound Library Selection:

  • Fragment-based libraries for initial screening

  • Natural product libraries enriched for membrane-active compounds

  • Focused libraries based on known ligands of related membrane proteins

  • Diversity-oriented synthesis libraries to maximize chemical space coverage

• Screening Workflow:

  • Primary screen at single concentration (typically 10 μM)

  • Dose-response curves for hits (typically 8-12 concentrations)

  • Counter-screens to eliminate false positives

  • Orthogonal assays to confirm mechanism of action

• Hit Validation and Optimization:

  • Structure-activity relationship studies

  • Binding site identification through mutagenesis

  • Mode of action studies (antagonist vs. agonist)

  • Assessment of selectivity against related membrane proteins

This systematic approach enables identification of chemical probes that can help elucidate yebN function and potentially lead to new antimicrobial strategies targeting Shigella sonnei .

What are the emerging techniques for studying membrane protein dynamics that could be applied to yebN research?

Several cutting-edge techniques are revolutionizing membrane protein research and could be applied to study yebN dynamics:

• Advanced Structural Biology Approaches:

  • Single-particle cryo-electron microscopy to capture different conformational states

  • Time-resolved X-ray crystallography to observe conformational changes

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Nuclear magnetic resonance relaxation dispersion to quantify microsecond-millisecond dynamics

• Advanced Microscopy Techniques:

  • Single-molecule FRET to track conformational changes in real-time

  • High-speed atomic force microscopy to visualize structural dynamics

  • Super-resolution microscopy to map protein distribution in bacterial membranes

  • Correlative light and electron microscopy for integrated structural and functional studies

• Computational Methods:

  • Molecular dynamics simulations to predict conformational changes

  • Enhanced sampling techniques to access longer timescales

  • Markov state modeling to identify key conformational states

  • Machine learning approaches to predict structure from sequence

• Membrane Mimetic Systems:

  • Nanodiscs for controlled membrane environment studies

  • Lipid cubic phases for crystallization and functional studies

  • Cell-free expression systems for direct incorporation into membranes

  • Polymer-based membrane mimetics for stability in harsh conditions

Application of these emerging techniques to yebN would provide unprecedented insights into how this membrane protein functions within the bacterial membrane environment and potentially reveal new approaches for targeting Shigella sonnei infections .

What quality control methods should be implemented to ensure the integrity and functionality of recombinant yebN protein preparations?

Ensuring the quality of recombinant yebN protein preparations requires rigorous quality control protocols:

• Purity Assessment Methods:

  • SDS-PAGE with Coomassie staining (target: >90% purity)

  • Western blot analysis with tag-specific or protein-specific antibodies

  • Size exclusion chromatography to assess aggregation state

  • Mass spectrometry to confirm protein identity and detect modifications

• Structural Integrity Verification:

• Functional Validation:

  • Reconstitution into liposomes to verify membrane integration

  • Activity assays based on predicted function (if known)

  • Binding assays with known interaction partners

  • Patch-clamp electrophysiology if ion channel activity is suspected

• Stability Monitoring:

  • Accelerated stability studies at elevated temperatures

  • Regular testing of stored samples at defined time points

  • Monitoring by SEC-MALS to detect aggregation over time

How can isotope labeling be effectively applied to study yebN protein structure and interactions using NMR spectroscopy?

Isotope labeling strategies enable sophisticated NMR studies of yebN structure and dynamics:

• Labeling Strategy Selection:

  • Uniform 15N labeling for backbone assignment and dynamics

  • 13C/15N double labeling for complete structure determination

  • Selective amino acid labeling to reduce spectral complexity

  • Methyl-specific labeling (Ile, Leu, Val) for studying large membrane proteins

  • Segmental labeling for focusing on specific domains

• Expression Optimization for Labeled Protein:

  • Minimal media formulation with 15N-ammonium chloride and/or 13C-glucose

  • High-density fermentation to maximize yield (targeting 100 mg/L)

  • Induction conditions optimization to balance expression and proper folding

  • Deuteration strategies to improve spectral quality for larger proteins

• NMR Experimental Approaches:

  • TROSY-based experiments for optimal sensitivity with membrane proteins

  • Solid-state NMR for studying yebN in lipid bilayers

  • Paramagnetic relaxation enhancement to obtain long-range distance constraints

  • Residual dipolar coupling measurements for orientation information

• Membrane Mimetic Selection for NMR:

  • Detergent micelles (DDM, DPC) for solution NMR

  • Bicelles for solution or solid-state NMR

  • Nanodiscs for a more native-like membrane environment

  • Oriented bilayers for solid-state NMR

These approaches allow researchers to obtain atomic-level insights into yebN structure, dynamics, and interactions, contributing to a mechanistic understanding of its function in Shigella sonnei .