Recombinant Shigella sonnei UPF0114 protein YqhA (yqhA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Shigella sonnei UPF0114 Protein YqhA (yqhA)

Shigella sonnei is a bacterium that causes diarrheal diseases worldwide, and it is becoming more prevalent compared to other Shigella species due to demographic and resistance factors . The UPF0114 protein YqhA, also known as YqhA protein, is a protein derived from Shigella sonnei .

Characteristics of Recombinant YqhA Protein

Recombinant Shigella sonnei UPF0114 protein YqhA (yqhA) is a full-length protein (1-164 amino acids) expressed in E. coli and fused to an N-terminal His tag .

Table 1: Properties of Recombinant Shigella sonnei UPF0114 Protein YqhA (yqhA)

PropertyDescription
SpeciesShigella sonnei
SourceE. coli
TagHis
Protein LengthFull Length (1-164 amino acids)
FormLyophilized powder
AA SequenceMERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended.
Gene NameyqhA
SynonymsyqhA; SSON_3146; UPF0114 protein YqhA
UniProt IDQ3YXN2
Expression Region1-164

Function and Significance

The YqhA protein is annotated as a UPF0114 protein, which stands for "Unknown Protein Function" . Although the precise function of YqhA in Shigella sonnei is not fully understood, studies have explored the outer membrane proteins (OMPs) of Shigella sonnei to identify antigenic proteins recognized by host antibodies . Identifying these proteins can provide valuable insights into the pathogenesis of Shigella infections and aid in developing targeted interventions.

Applications in Research

Recombinant YqhA protein can be utilized in various research applications:

  • ELISA assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies against Shigella sonnei .

  • Biomarker discovery: The protein can be used in studies aimed at identifying specific biomarkers for Shigella sonnei infection .

  • Vaccine development: Recombinant proteins like YqhA can be investigated as potential vaccine candidates or components for developing vaccines against Shigella .

  • Protein-protein interaction studies: Employing recombinant YqhA protein in interaction studies can help reveal its binding partners and functional roles within the bacterium .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yqhA; SSON_3146; UPF0114 protein YqhA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
yqhA
Target Protein Sequence
MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSL VDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIH LLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0114 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the yqhA gene in Shigella sonnei?

The yqhA gene in S. sonnei is chromosomally encoded rather than plasmid-borne. Unlike some of the antimicrobial resistance genes that have been found integrated into the chromosome from plasmids (such as the IncFII plasmid integration described in recent research), yqhA is part of the core genome of S. sonnei . When designing experiments to study this gene, researchers should consider its genomic neighborhood and potential operon structure, as these may provide clues to its function. Sequence analysis and comparison with related genes in other enterobacteria can provide initial insights into potential functional roles.

How can I confirm expression of yqhA in my Shigella sonnei isolates?

Expression of yqhA can be confirmed through several complementary approaches:

  • RT-PCR or qRT-PCR to detect gene transcription

  • Western blotting using antibodies specific to YqhA

  • Mass spectrometry-based proteomic analysis

When performing these analyses, it's important to compare expression under different growth conditions, as the yqhA gene may be differentially regulated under various environmental stresses or growth phases. Similar to approaches used in studies of S. sonnei membrane proteins, multiple growth conditions should be tested to establish a complete expression profile .

What are the predicted structural features of the YqhA protein?

YqhA belongs to the UPF0114 family of uncharacterized proteins that are typically small membrane-associated proteins. Bioinformatic analysis indicates that YqhA likely contains transmembrane domains and may be associated with the bacterial cell envelope. Structure prediction algorithms suggest potential roles in membrane integrity or transport functions, though experimental validation is required. The protein may share structural features with other bacterial membrane proteins that have been identified in GMMA (Generalized Modules for Membrane Antigens) preparations of S. sonnei .

What are the optimal conditions for recombinant expression of S. sonnei YqhA?

Successful recombinant expression of membrane-associated proteins like YqhA requires careful optimization. Based on approaches used for other Shigella membrane proteins, the following expression system parameters should be considered:

ParameterRecommended OptionsConsiderations
Expression SystemE. coli BL21(DE3), C43(DE3), or RosettaC43(DE3) often performs better for membrane proteins
Expression VectorpET series with 6xHis or other affinity tagsC-terminal tags may interfere less with membrane insertion
InductionIPTG concentration: 0.1-0.5 mMLower concentrations and longer expression times preferred
Temperature16-25°CLower temperatures reduce inclusion body formation
Media Supplements0.5-1% glucose, 1% ethanol, or osmolytesCan improve folding of membrane proteins

The expression system should be designed based on methodologies similar to those employed in proteomic analysis of S. sonnei GMMA, where membrane proteins are carefully isolated and characterized .

What purification strategies are most effective for recombinant YqhA?

Purification of membrane-associated proteins like YqhA presents specific challenges. A multi-step purification protocol is recommended:

  • Membrane fraction isolation using differential centrifugation

  • Solubilization with appropriate detergents (DDM, LDAO, or CHAPS at 1-2%)

  • Affinity chromatography using the engineered tag

  • Size exclusion chromatography for final purification

When selecting detergents, consider their compatibility with downstream applications such as crystallography or functional assays. Detergent screening may be necessary to identify optimal conditions for YqhA solubilization while maintaining native conformation. Approaches similar to those used in membrane protein isolation from S. sonnei for immunological studies can be adapted for YqhA purification .

How can I assess the functional activity of purified YqhA protein?

Since YqhA is an uncharacterized protein, functional activity assays must be developed based on predicted functions or interactions. Consider the following approaches:

  • Liposome incorporation assays to test membrane integration

  • Ion flux measurements if channel/transporter activity is suspected

  • Protein-protein interaction studies using pull-down assays or yeast two-hybrid screens

  • Lipid binding assays if membrane association is confirmed

For each assay, appropriate controls including known membrane proteins from S. sonnei should be included. The methodological approaches used to characterize membrane proteins in GMMA preparations can be adapted for functional characterization of YqhA .

How does plasmid integration into the S. sonnei chromosome affect yqhA expression and function?

The recent discovery of IncFII plasmid integration into the S. sonnei chromosome raises important questions about genome plasticity and potential effects on chromosomal genes like yqhA . To investigate this:

  • Compare yqhA expression levels in strains with and without integrated plasmids

  • Determine if integration sites are near the yqhA locus using whole genome sequencing

  • Assess if mobile genetic elements like insertion sequences affect yqhA regulation

  • Evaluate potential co-regulation between yqhA and plasmid-derived genes post-integration

The presence of approximately 465 insertion sequence elements in the S. sonnei genome, with IS1 family elements accounting for approximately 37% of these, suggests high genomic plasticity that could influence yqhA expression .

What role might YqhA play in antimicrobial resistance mechanisms in S. sonnei?

While YqhA itself is not known to be a resistance determinant, it could potentially be involved in membrane-associated processes that influence antimicrobial resistance:

  • Design knockout and overexpression studies to evaluate changes in antimicrobial susceptibility profiles

  • Assess interactions between YqhA and known resistance proteins like efflux pumps

  • Investigate YqhA expression in response to antimicrobial exposure

  • Examine correlations between yqhA sequence variations and resistance phenotypes in clinical isolates

The emergence of extensively drug-resistant S. sonnei strains underscores the importance of understanding all factors that might contribute to resistance phenotypes, including potentially uncharacterized membrane proteins .

Can structural biology approaches resolve the function of YqhA?

Structural determination of membrane proteins presents significant challenges but can provide crucial insights:

  • X-ray crystallography requires extensive optimization of purification and crystallization conditions

  • Cryo-electron microscopy (cryo-EM) may be suitable for YqhA if it forms complexes or oligomers

  • NMR spectroscopy could be applicable for specific domains or the full protein depending on size

  • Computational approaches (AlphaFold2, RoseTTAFold) can provide initial structural models for experimental validation

The structural data should be correlated with biochemical and genetic studies to develop comprehensive functional hypotheses. Approaches used to characterize membrane protein structures in S. sonnei can inform these studies .

How do I investigate potential roles of YqhA in S. sonnei virulence?

To assess YqhA's potential involvement in pathogenesis:

  • Generate yqhA deletion mutants and complemented strains

  • Compare virulence phenotypes in cell culture invasion assays

  • Evaluate intracellular survival and replication capabilities

  • Assess bacterial fitness in stress conditions relevant to the infection process

As S. sonnei virulence is typically associated with the virulence plasmid (pSS), which carries genes like virG , it's important to determine if YqhA interacts with plasmid-encoded virulence factors or contributes to maintaining plasmid stability.

Could YqhA be a potential vaccine target against S. sonnei?

Assessment of YqhA as a vaccine candidate requires several considerations:

  • Determine surface exposure and accessibility to antibodies

  • Evaluate conservation across S. sonnei clinical isolates

  • Assess immunogenicity and ability to elicit protective responses

  • Consider incorporation into existing vaccine platforms like GMMA

What techniques should I use to measure host immune responses to YqhA?

Characterizing immune responses to YqhA requires:

  • ELISA assays to detect specific antibody responses in infected or immunized hosts

  • ELISpot or flow cytometry to measure T-cell responses

  • Functional antibody assays like serum bactericidal activity (SBA)

  • In vivo protection studies in animal models

When analyzing immune responses, consider how the presence of O-antigen might shield protein antigens like YqhA from antibody recognition, as has been observed with other S. sonnei surface proteins . The methodologies developed for assessing serum bactericidal activity against S. sonnei can be adapted to evaluate the contribution of anti-YqhA antibodies to protective immunity .

How conserved is yqhA across different S. sonnei isolates and Shigella species?

Understanding the conservation of yqhA is essential for determining its fundamental importance:

  • Perform comparative genomic analysis across multiple S. sonnei isolates

  • Compare sequences with other Shigella species and E. coli

  • Identify conserved domains and variable regions

  • Determine selection pressures acting on the gene

Given the close relationship between Shigella and E. coli, examining orthologs in E. coli (which can act as reservoirs for resistance genes in Shigella) may provide insights into YqhA function .

What experimental approaches can identify protein interaction partners of YqhA?

To elucidate the functional network of YqhA:

ApproachAdvantagesLimitationsConsiderations for YqhA
Co-immunoprecipitationDirect identification of interacting proteinsRequires good antibodiesMembrane location requires careful solubilization
Bacterial two-hybridIn vivo detection of interactionsMay miss weak interactionsCan be adapted for membrane proteins
Cross-linking mass spectrometryCaptures transient interactionsComplex data analysisEffective for membrane protein complexes
Proximity labeling (BioID, APEX)Identifies spatial neighborsCan give false positivesWorks well for membrane protein neighborhoods

The proteomic approaches used to characterize S. sonnei GMMA components can be adapted to identify YqhA interaction partners in their native membrane environment .

How can transcriptomic analysis inform our understanding of yqhA regulation?

RNA-seq and related approaches can reveal regulatory patterns:

  • Compare yqhA expression across growth phases and environmental conditions

  • Identify co-regulated genes that may share functions with yqhA

  • Map transcription start sites and regulatory elements using 5' RACE or similar techniques

  • Determine if yqhA is part of stress response pathways

The conditions studied should include those relevant to S. sonnei pathogenesis, such as acid stress, bile exposure, and intracellular environments, as well as exposure to antibiotics, given the emerging concerns about extensively drug-resistant S. sonnei strains .

What are the most promising approaches to determine the definitive function of YqhA?

A multidisciplinary approach is recommended:

  • Combine structural studies with targeted mutagenesis of key residues

  • Utilize global approaches (transcriptomics, proteomics, metabolomics) to identify phenotypes in knockout strains

  • Develop high-throughput screening methods to identify conditions where YqhA function is critical

  • Consider evolutionary approaches to infer function from patterns of conservation and co-evolution

The increasing concern about antimicrobial resistance in S. sonnei highlights the importance of understanding all components of this pathogen, including uncharacterized proteins like YqhA that may contribute to bacterial fitness or virulence .

How should researchers approach contradictory data regarding YqhA function?

When facing conflicting results:

  • Carefully document all experimental conditions to identify variables that might explain differences

  • Consider strain-specific effects, as S. sonnei isolates show genomic plasticity

  • Examine if the presence of mobile genetic elements or integrated plasmids affects results

  • Validate findings using complementary approaches and multiple strains

The recent finding of IncFII plasmid integration into the S. sonnei chromosome highlights how genomic plasticity can influence gene expression and function, potentially leading to variable results across different studies or isolates .

What are the ethical considerations for research involving recombinant S. sonnei proteins?

Researchers should consider:

  • Biosafety requirements appropriate for working with Shigella components

  • Potential dual-use implications of research on bacterial proteins

  • Responsible reporting of findings related to pathogenesis or antimicrobial resistance

  • Inclusive approaches to ensure research benefits populations most affected by shigellosis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.