Shigella sonnei is a bacterium that causes diarrheal diseases worldwide, and it is becoming more prevalent compared to other Shigella species due to demographic and resistance factors . The UPF0114 protein YqhA, also known as YqhA protein, is a protein derived from Shigella sonnei .
Recombinant Shigella sonnei UPF0114 protein YqhA (yqhA) is a full-length protein (1-164 amino acids) expressed in E. coli and fused to an N-terminal His tag .
| Property | Description |
|---|---|
| Species | Shigella sonnei |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-164 amino acids) |
| Form | Lyophilized powder |
| AA Sequence | MERFLENAMYASRWLLAPVYFGLSLALVALALKFFQEIIHVLPNIFSMAESDLILVLLSLVDMTLVGGLLVMVMFSGYENFVSQLDISENKEKLNWLGKMDATSLKNKVAASIVAISSIHLLRVFMDAKNVPDNKLMWYVIIHLTFVLSAFVMGYLDRLTRHNH |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended. |
| Gene Name | yqhA |
| Synonyms | yqhA; SSON_3146; UPF0114 protein YqhA |
| UniProt ID | Q3YXN2 |
| Expression Region | 1-164 |
The YqhA protein is annotated as a UPF0114 protein, which stands for "Unknown Protein Function" . Although the precise function of YqhA in Shigella sonnei is not fully understood, studies have explored the outer membrane proteins (OMPs) of Shigella sonnei to identify antigenic proteins recognized by host antibodies . Identifying these proteins can provide valuable insights into the pathogenesis of Shigella infections and aid in developing targeted interventions.
Recombinant YqhA protein can be utilized in various research applications:
ELISA assays: It can be used as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies against Shigella sonnei .
Biomarker discovery: The protein can be used in studies aimed at identifying specific biomarkers for Shigella sonnei infection .
Vaccine development: Recombinant proteins like YqhA can be investigated as potential vaccine candidates or components for developing vaccines against Shigella .
Protein-protein interaction studies: Employing recombinant YqhA protein in interaction studies can help reveal its binding partners and functional roles within the bacterium .
KEGG: ssn:SSON_3146
The yqhA gene in S. sonnei is chromosomally encoded rather than plasmid-borne. Unlike some of the antimicrobial resistance genes that have been found integrated into the chromosome from plasmids (such as the IncFII plasmid integration described in recent research), yqhA is part of the core genome of S. sonnei . When designing experiments to study this gene, researchers should consider its genomic neighborhood and potential operon structure, as these may provide clues to its function. Sequence analysis and comparison with related genes in other enterobacteria can provide initial insights into potential functional roles.
Expression of yqhA can be confirmed through several complementary approaches:
RT-PCR or qRT-PCR to detect gene transcription
Western blotting using antibodies specific to YqhA
Mass spectrometry-based proteomic analysis
When performing these analyses, it's important to compare expression under different growth conditions, as the yqhA gene may be differentially regulated under various environmental stresses or growth phases. Similar to approaches used in studies of S. sonnei membrane proteins, multiple growth conditions should be tested to establish a complete expression profile .
YqhA belongs to the UPF0114 family of uncharacterized proteins that are typically small membrane-associated proteins. Bioinformatic analysis indicates that YqhA likely contains transmembrane domains and may be associated with the bacterial cell envelope. Structure prediction algorithms suggest potential roles in membrane integrity or transport functions, though experimental validation is required. The protein may share structural features with other bacterial membrane proteins that have been identified in GMMA (Generalized Modules for Membrane Antigens) preparations of S. sonnei .
Successful recombinant expression of membrane-associated proteins like YqhA requires careful optimization. Based on approaches used for other Shigella membrane proteins, the following expression system parameters should be considered:
| Parameter | Recommended Options | Considerations |
|---|---|---|
| Expression System | E. coli BL21(DE3), C43(DE3), or Rosetta | C43(DE3) often performs better for membrane proteins |
| Expression Vector | pET series with 6xHis or other affinity tags | C-terminal tags may interfere less with membrane insertion |
| Induction | IPTG concentration: 0.1-0.5 mM | Lower concentrations and longer expression times preferred |
| Temperature | 16-25°C | Lower temperatures reduce inclusion body formation |
| Media Supplements | 0.5-1% glucose, 1% ethanol, or osmolytes | Can improve folding of membrane proteins |
The expression system should be designed based on methodologies similar to those employed in proteomic analysis of S. sonnei GMMA, where membrane proteins are carefully isolated and characterized .
Purification of membrane-associated proteins like YqhA presents specific challenges. A multi-step purification protocol is recommended:
Membrane fraction isolation using differential centrifugation
Solubilization with appropriate detergents (DDM, LDAO, or CHAPS at 1-2%)
Affinity chromatography using the engineered tag
Size exclusion chromatography for final purification
When selecting detergents, consider their compatibility with downstream applications such as crystallography or functional assays. Detergent screening may be necessary to identify optimal conditions for YqhA solubilization while maintaining native conformation. Approaches similar to those used in membrane protein isolation from S. sonnei for immunological studies can be adapted for YqhA purification .
Since YqhA is an uncharacterized protein, functional activity assays must be developed based on predicted functions or interactions. Consider the following approaches:
Liposome incorporation assays to test membrane integration
Ion flux measurements if channel/transporter activity is suspected
Protein-protein interaction studies using pull-down assays or yeast two-hybrid screens
Lipid binding assays if membrane association is confirmed
For each assay, appropriate controls including known membrane proteins from S. sonnei should be included. The methodological approaches used to characterize membrane proteins in GMMA preparations can be adapted for functional characterization of YqhA .
The recent discovery of IncFII plasmid integration into the S. sonnei chromosome raises important questions about genome plasticity and potential effects on chromosomal genes like yqhA . To investigate this:
Compare yqhA expression levels in strains with and without integrated plasmids
Determine if integration sites are near the yqhA locus using whole genome sequencing
Assess if mobile genetic elements like insertion sequences affect yqhA regulation
Evaluate potential co-regulation between yqhA and plasmid-derived genes post-integration
The presence of approximately 465 insertion sequence elements in the S. sonnei genome, with IS1 family elements accounting for approximately 37% of these, suggests high genomic plasticity that could influence yqhA expression .
While YqhA itself is not known to be a resistance determinant, it could potentially be involved in membrane-associated processes that influence antimicrobial resistance:
Design knockout and overexpression studies to evaluate changes in antimicrobial susceptibility profiles
Assess interactions between YqhA and known resistance proteins like efflux pumps
Investigate YqhA expression in response to antimicrobial exposure
Examine correlations between yqhA sequence variations and resistance phenotypes in clinical isolates
The emergence of extensively drug-resistant S. sonnei strains underscores the importance of understanding all factors that might contribute to resistance phenotypes, including potentially uncharacterized membrane proteins .
Structural determination of membrane proteins presents significant challenges but can provide crucial insights:
X-ray crystallography requires extensive optimization of purification and crystallization conditions
Cryo-electron microscopy (cryo-EM) may be suitable for YqhA if it forms complexes or oligomers
NMR spectroscopy could be applicable for specific domains or the full protein depending on size
Computational approaches (AlphaFold2, RoseTTAFold) can provide initial structural models for experimental validation
The structural data should be correlated with biochemical and genetic studies to develop comprehensive functional hypotheses. Approaches used to characterize membrane protein structures in S. sonnei can inform these studies .
To assess YqhA's potential involvement in pathogenesis:
Generate yqhA deletion mutants and complemented strains
Compare virulence phenotypes in cell culture invasion assays
Evaluate intracellular survival and replication capabilities
Assess bacterial fitness in stress conditions relevant to the infection process
As S. sonnei virulence is typically associated with the virulence plasmid (pSS), which carries genes like virG , it's important to determine if YqhA interacts with plasmid-encoded virulence factors or contributes to maintaining plasmid stability.
Assessment of YqhA as a vaccine candidate requires several considerations:
Determine surface exposure and accessibility to antibodies
Evaluate conservation across S. sonnei clinical isolates
Assess immunogenicity and ability to elicit protective responses
Consider incorporation into existing vaccine platforms like GMMA
Characterizing immune responses to YqhA requires:
ELISA assays to detect specific antibody responses in infected or immunized hosts
ELISpot or flow cytometry to measure T-cell responses
Functional antibody assays like serum bactericidal activity (SBA)
In vivo protection studies in animal models
When analyzing immune responses, consider how the presence of O-antigen might shield protein antigens like YqhA from antibody recognition, as has been observed with other S. sonnei surface proteins . The methodologies developed for assessing serum bactericidal activity against S. sonnei can be adapted to evaluate the contribution of anti-YqhA antibodies to protective immunity .
Understanding the conservation of yqhA is essential for determining its fundamental importance:
Perform comparative genomic analysis across multiple S. sonnei isolates
Compare sequences with other Shigella species and E. coli
Identify conserved domains and variable regions
Determine selection pressures acting on the gene
Given the close relationship between Shigella and E. coli, examining orthologs in E. coli (which can act as reservoirs for resistance genes in Shigella) may provide insights into YqhA function .
To elucidate the functional network of YqhA:
| Approach | Advantages | Limitations | Considerations for YqhA |
|---|---|---|---|
| Co-immunoprecipitation | Direct identification of interacting proteins | Requires good antibodies | Membrane location requires careful solubilization |
| Bacterial two-hybrid | In vivo detection of interactions | May miss weak interactions | Can be adapted for membrane proteins |
| Cross-linking mass spectrometry | Captures transient interactions | Complex data analysis | Effective for membrane protein complexes |
| Proximity labeling (BioID, APEX) | Identifies spatial neighbors | Can give false positives | Works well for membrane protein neighborhoods |
The proteomic approaches used to characterize S. sonnei GMMA components can be adapted to identify YqhA interaction partners in their native membrane environment .
RNA-seq and related approaches can reveal regulatory patterns:
Compare yqhA expression across growth phases and environmental conditions
Identify co-regulated genes that may share functions with yqhA
Map transcription start sites and regulatory elements using 5' RACE or similar techniques
Determine if yqhA is part of stress response pathways
The conditions studied should include those relevant to S. sonnei pathogenesis, such as acid stress, bile exposure, and intracellular environments, as well as exposure to antibiotics, given the emerging concerns about extensively drug-resistant S. sonnei strains .
A multidisciplinary approach is recommended:
Combine structural studies with targeted mutagenesis of key residues
Utilize global approaches (transcriptomics, proteomics, metabolomics) to identify phenotypes in knockout strains
Develop high-throughput screening methods to identify conditions where YqhA function is critical
Consider evolutionary approaches to infer function from patterns of conservation and co-evolution
The increasing concern about antimicrobial resistance in S. sonnei highlights the importance of understanding all components of this pathogen, including uncharacterized proteins like YqhA that may contribute to bacterial fitness or virulence .
When facing conflicting results:
Carefully document all experimental conditions to identify variables that might explain differences
Consider strain-specific effects, as S. sonnei isolates show genomic plasticity
Examine if the presence of mobile genetic elements or integrated plasmids affects results
Validate findings using complementary approaches and multiple strains
The recent finding of IncFII plasmid integration into the S. sonnei chromosome highlights how genomic plasticity can influence gene expression and function, potentially leading to variable results across different studies or isolates .
Researchers should consider:
Biosafety requirements appropriate for working with Shigella components
Potential dual-use implications of research on bacterial proteins
Responsible reporting of findings related to pathogenesis or antimicrobial resistance
Inclusive approaches to ensure research benefits populations most affected by shigellosis