Recombinant Shigella sonnei UPF0208 membrane protein YfbV (yfbV)

Shipped with Ice Packs
In Stock

Description

General Information

YfbV is a membrane protein belonging to Shigella sonnei, identified as UPF0208, and is also referred to as YfbV . It has a molecular weight of approximately 29.0 kDa . Creative BioMart offers a recombinant full-length Shigella sonnei UPF0208 membrane protein YfbV(yfbV) Protein, His-Tagged, which is expressed in E. coli . The protein sequence consists of 151 amino acids, tagged with N-terminal His .

Research and Findings

Shigella spp. are the cause of bacillary dysentery, a common health problem worldwide . S. sonnei is the most frequently isolated species causing shigellosis in industrialized countries . Early identification of this multidrug-resistant organism from patients is rare .

Outer Membrane Proteins (OMPs) as Diagnostic Biomarkers: OMPs of S. sonnei have potential as diagnostic biomarkers for detecting S. sonnei infections . Three OMPs with sizes 33.3 kDa, 43.8 kDa, and 100.3 kDa are uniquely recognized by IgA and IgG from patients infected with S. sonnei and do not cross-react with sera from patients with other infections . In addition to these, two other proteins of sizes 29.0 kDa and 88.2 kDa were also exclusively recognized by IgA when probed with S. sonnei sera .

YfbV and YfiB Similarity: YfbV is similar to YfiB, an outer membrane protein involved in the virulence of Shigella flexneri . YfiB positively regulates YfiN’s diguanylate cyclase (DGC) activity by sequestering YfiR to the outer membrane, preventing its binding to YfiN and releasing its inhibition .

Experimental Analysis of OMPs

Profiling of OMPs: OMPs of S. sonnei are analyzed using sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) to identify protein profiles based on differences in their molecular weights . A discontinuous SDS-PAGE protocol is utilized, where protein samples containing 30 ug of proteins are resolved on 10% polyacrylamide gel . The OMPs are then visualized via SDS-PAGE gel stained with Coomassie brilliant blue .

Immunoblot Analysis: Immunoblot analysis is performed to determine the immunogenicity of OMPs . Proteins are transferred onto PVDF membranes and probed with human sera . The membranes are incubated with secondary antibodies, and the reaction is developed with alkaline phosphatase conjugated substrate .

Tables of related proteins

ProteinMolecular Weight (kDa)Recognition by IgA/IgGCross-ReactivityPotential Role
YfbV~29.0Yes (IgA)NoDiagnostic biomarker
33.3 kDa OMP33.3Yes (IgA and IgG)NoDiagnostic biomarker
43.8 kDa OMP43.8Yes (IgA and IgG)NoDiagnostic biomarker
100.3 kDa OMP100.3Yes (IgA and IgG)NoDiagnostic biomarker
88.2 kDa protein88.2Yes (IgA)NoDiagnostic biomarker
YfiB (in S. flexneri)UnknownUnknownUnknownRegulation of YfiN, virulence of S. flexneri

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yfbV; SSON_2352; UPF0208 membrane protein YfbV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
yfbV
Target Protein Sequence
MSTPDNRSVNFFSLFRRGQHYSKTWPLEKRLAPVFVENRVIKMTRYAIRFMPPIAVFTLC WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSVTPLPPAILNWFYEVRGKLQESGQVL APVEGKPDYQALADTLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0208 membrane protein YfbV in Shigella sonnei and how is it classified?

The UPF0208 membrane protein YfbV belongs to a family of conserved bacterial membrane proteins found in Shigella sonnei, one of the four species within the Shigella genus. Shigella is a Gram-negative, nonspore-forming, nonmotile, facultative aerobic, rod-shaped bacteria first discovered in 1897. Shigella species cause disease primarily in primates, including humans and gorillas, but not in other mammals . The YfbV protein likely plays a role in membrane integrity and possibly in host-pathogen interactions, similar to other membrane proteins that have been characterized in Shigella and related Enterobacteriaceae.

Shigella sonnei is one of the four major Shigella species/serogroups, alongside S. dysenteriae, S. flexneri, and S. boydii. While S. flexneri accounts for approximately 60% of Shigella isolations worldwide, S. sonnei remains an important pathogen in specific geographical regions and is becoming increasingly prevalent in developing countries undergoing economic transition .

What extraction methods are most effective for isolating YfbV protein from Shigella sonnei?

Based on established protocols for outer membrane proteins of Shigella, the most effective extraction method for YfbV would involve a multi-step process similar to that used for other membrane proteins. The recommended methodology includes:

  • Culture growth: Grow Shigella sonnei at 37°C in nutrient broth for 18 hours with shaking at 200 rpm to achieve optimal cell density.

  • Cell harvesting: Centrifuge the culture at approximately 15,900 x g for 30 minutes to collect bacterial cells.

  • Resuspension: Resuspend the cell pellet in HEPES buffer (0.01M, pH 7.4) supplemented with DNase, RNase, and phenylmethylsulfonyl fluoride to prevent nucleic acid contamination and protein degradation.

  • Cell disruption: Lyse cells using glass beads (approximately 0.2 mm diameter) with vortexing for 1.5 hours, alternating with cooling on ice until achieving 95% cell lysis.

  • Differential centrifugation: Remove unlysed cells with low-speed centrifugation (7,800 x g at 4°C for 15 minutes), followed by ultracentrifugation of the supernatant at 145,100 x g at 4°C for 1 hour to isolate the membrane fraction.

  • Detergent extraction: Treat the membrane fraction with Triton X-100 (4%) to solubilize the inner membrane, leaving the outer membrane fraction containing the desired proteins .

This established methodology provides a foundation for isolating membrane proteins like YfbV from Shigella sonnei with high purity and integrity for subsequent analysis.

What analytical techniques are recommended for characterizing YfbV protein structure and function?

For comprehensive characterization of YfbV protein structure and function, a multi-technique approach is recommended:

  • SDS-PAGE profiling: Analyze protein using discontinuous SDS-PAGE with 10% polyacrylamide gel to determine molecular weight and purity. Load approximately 30 μg of protein per well and run at 35 mA for optimal resolution .

  • Western blot analysis: Employ Western blotting using nitrocellulose membranes (0.45 μm pore size) with overnight transfer at controlled voltage. Block membranes with 3% skim milk and probe with specific antibodies to detect YfbV and assess cross-reactivity with antibodies from patients infected with Shigella or related pathogens .

  • Glycan binding assays: If YfbV is suspected to have adhesin properties (like related membrane proteins), employ glycan microarray analysis to identify potential binding partners. Recombinant protein and whole-cell binding assays can reveal differential binding patterns to structures like N-acetylglucosamine and mannose glycans .

  • Surface plasmon resonance: Quantify binding affinities of YfbV to identified ligands using surface plasmon resonance, with His-tagged recombinant protein constructs as targets against various glycan structures. This technique has successfully determined nanomolar binding affinities for related membrane proteins .

  • Enzyme immunoassay: Determine immunoglobulin profiles against YfbV by dot enzyme immunoassay using sera from infected patients, probing with IgA and IgG as primary antibodies and visualizing with alkaline phosphatase-conjugated secondary antibodies .

These analytical approaches provide complementary data about YfbV's physical properties, potential binding partners, and immunological significance.

How does the molecular function of YfbV compare with other characterized membrane proteins in Enterobacteriaceae?

YfbV likely shares functional characteristics with other membrane proteins in Enterobacteriaceae that have been better characterized. The UPF0208 family remains somewhat enigmatic, but comparative analysis with proteins like YtfB offers valuable insights.

YtfB, a related membrane protein found in E. coli, provides a useful comparative model. YtfB contains two key domains: a transmembrane domain near the N-terminus and a LysM-like domain at the C-terminus . The LysM domains are involved in binding polysaccharides found on bacterial, plant, and eukaryotic cell surfaces, suggesting adhesion functions. Similarly, YfbV may possess domains that enable interactions with host cell surfaces or bacterial cell wall components.

Research on related proteins reveals binding specificity to glycan structures. For instance, YtfB demonstrates high-affinity binding to specific N-acetylglucosamine structures (hexaacetylchitohexaose with KD of 24.8 nM±5.3 nM) and mannobiose structures (α1-4mannobiose with KD of 31.2 nM) . This suggests that YfbV might similarly interact with specific glycan structures, potentially playing roles in adhesion during infection or colonization.

Protein-protein interaction analysis using techniques like STRING has predicted interactions between membrane proteins like YtfB and cell division proteins like DamX . By extension, YfbV may participate in similar protein interaction networks, potentially influencing bacterial cell division or filamentation during infection cycles.

What genetic engineering approaches can be used to create YfbV mutants for functional studies?

Creating YfbV mutants for functional studies requires sophisticated genetic engineering approaches as demonstrated with other Shigella membrane proteins. Based on established methodologies, the following approach is recommended:

  • Parent strain selection: Begin with a well-characterized strain such as Shigella sonnei 53G as the parent strain for genetic modifications .

  • Null mutant generation: Replace the yfbV coding sequence with an antibiotic resistance cassette using a three-step PCR protocol:

    • Amplify upstream and downstream regions of yfbV from genomic DNA

    • Amplify an appropriate antibiotic resistance gene (kanamycin, chloramphenicol, or erythromycin)

    • Fuse these three fragments in a single PCR reaction using the appropriate primers

  • Transformation approach: Transform recombination-prone Shigella sonnei cells carrying a helper plasmid like pAJD434 with the linear replacement fragment. The helper plasmid contains the Red operon to enhance homologous recombination efficiency .

  • Mutant verification: Confirm successful mutations through PCR verification of:

    • Absence of the targeted gene

    • Presence of the antibiotic resistance marker

    • Sequence integrity of adjacent regions to ensure no unintended mutations occurred

  • Virulence plasmid considerations: For comprehensive functional studies, create variants with and without the virulence plasmid to assess how YfbV function relates to virulence mechanisms. The virulence plasmid status can be verified through PCR detection of plasmid-specific sequences like the origin of replication and plasmid-encoded genes .

This genetic engineering approach enables the creation of isogenic mutants for rigorous comparative functional studies of YfbV.

What is the role of YfbV in Shigella sonnei virulence and host-pathogen interactions?

The role of YfbV in Shigella sonnei virulence likely involves multiple aspects of host-pathogen interactions, though direct evidence specific to YfbV is limited. Extrapolating from studies of similar membrane proteins provides valuable insights:

Membrane proteins in Shigella often function as adhesins, mediating attachment to host cell surfaces. For example, studies of membrane proteins in related species have demonstrated specific binding to epithelial cells . The UPF0208 family member YfbV may similarly facilitate initial adherence to intestinal epithelial cells during Shigella infection.

Glycan binding appears to be a crucial function of bacterial membrane proteins. Related proteins like YtfB show specific binding to structures including GlcNAcβ1-4GlcNAcβ1-4GlcNAc and Manα1-4Man with nanomolar affinity . YfbV may recognize similar glycan patterns on host cell surfaces, contributing to tissue tropism and colonization efficiency.

Some membrane proteins have been implicated in bacterial cell division and filamentation during infection cycles. For instance, DamX has been associated with reversible filamentation during uropathogenic E. coli infection . If YfbV interacts with cell division machinery, it might influence Shigella morphology during different stages of infection.

Recognition by the host immune system is another critical aspect. Outer membrane proteins of Shigella sonnei are recognized by antibodies from infected patients, suggesting they're immunogenic during natural infection . Comparative analysis of serum recognition patterns between YfbV and other OMPs could reveal its relative contribution to the host immune response during shigellosis.

How can recombinant YfbV protein be efficiently produced and purified for structural studies?

Efficient production and purification of recombinant YfbV protein for structural studies requires a systematic approach:

  • Expression system selection: Choose an appropriate expression system based on target characteristics. For membrane proteins like YfbV, E. coli remains a primary choice, though yeast, baculovirus, or mammalian cell systems may offer advantages for proper folding and post-translational modifications .

  • Construct design: Design expression constructs with consideration for:

    • Codon optimization for the selected expression system

    • Affinity tags (His-tag, GST) positioned to minimize interference with protein folding

    • Signal sequences for proper membrane localization if necessary

    • TEV protease cleavage sites for tag removal during purification

  • Expression optimization: Test multiple expression conditions including:

    • Induction temperature (typically lowered to 16-25°C for membrane proteins)

    • Inducer concentration

    • Expression duration

    • Media formulation

  • Extraction strategy: For membrane proteins like YfbV, extraction requires detergent solubilization. Screen detergents systematically, beginning with mild non-ionic detergents (DDM, LDAO) that typically preserve protein structure while effectively solubilizing membrane proteins.

  • Purification protocol: Implement a multi-step purification strategy:

    • Initial capture using affinity chromatography (IMAC for His-tagged constructs)

    • Tag removal using specific proteases if necessary

    • Secondary purification using ion exchange chromatography

    • Final polishing step using size exclusion chromatography

  • Stability assessment: Analyze protein stability through:

    • Thermal shift assays to identify buffer conditions promoting stability

    • Dynamic light scattering to assess homogeneity and aggregation status

    • Limited proteolysis to identify stable domains for crystallization

For structural studies specifically, consider reconstitution into nanodiscs or lipid cubic phases if traditional crystallization proves challenging, particularly given the membrane nature of YfbV.

How can researchers design experiments to investigate YfbV interactions with host glycan structures?

Investigating YfbV interactions with host glycan structures requires a systematic experimental approach:

  • Glycan microarray screening: Generate recombinant YfbV protein with appropriate tags and screen against comprehensive glycan arrays containing diverse glycan structures found in the human intestinal epithelium.

    • Primary screening: Compare binding patterns between wild-type and ΔyfbV Shigella sonnei cells to identify glycan structures specifically recognized by YfbV .

    • Secondary validation: Use purified recombinant YfbV protein to confirm direct binding to identified glycan targets.

    • Analyze data to identify structurally related glycans that show binding, revealing potential recognition patterns.

  • Surface plasmon resonance analysis: Determine binding affinities to identified glycan structures:

    • Immobilize His-tagged C-terminal domain of YfbV on sensor chips

    • Analyze binding kinetics with various concentrations of glycan structures

    • Calculate dissociation constants (KD) for each interaction

    • Construct a binding profile table similar to:

    Glycan structureKD (nM)Association rate (ka)Dissociation rate (kd)
    α1-4mannobiose~31.2To be determinedTo be determined
    GlcNAc trimer~25-30To be determinedTo be determined
  • Structure-function analysis: Generate YfbV variants with site-directed mutagenesis of predicted binding residues and assess:

    • Changes in glycan binding affinity and specificity

    • Alterations in bacterial adherence to epithelial cell lines

    • Effects on virulence in cellular infection models

  • Cell-based binding assays: Compare binding of wild-type and ΔyfbV mutants to intestinal epithelial cell lines with characterized glycosylation patterns to correlate glycan binding with cellular tropism.

This experimental approach will provide comprehensive insights into YfbV's role in glycan recognition during Shigella sonnei infection.

What protocols should be followed for investigating YfbV immunogenicity and potential vaccine applications?

Investigating YfbV immunogenicity and its potential as a vaccine component requires systematic analysis through these protocols:

  • Serum reactivity analysis:

    • Collect serum samples from:

      • Confirmed S. sonnei infection patients (acute and convalescent)

      • Patients infected with related pathogens (Salmonella, EPEC, etc.)

      • Healthy controls from endemic and non-endemic regions

    • Prepare purified YfbV protein using standardized protocols

    • Analyze antibody reactions using multiple techniques:

      • ELISA to quantify anti-YfbV IgG, IgA, and IgM titers

      • Western blot to confirm specificity of recognition

      • Dot enzyme immunoassay with IgA/IgG detection

  • Epitope mapping:

    • Generate overlapping peptides spanning the YfbV sequence

    • Screen peptides against patient sera to identify immunodominant regions

    • Confirm findings with competitive inhibition assays

    • Analyze data to distinguish conserved from variable epitopes

  • Functional antibody assessment:

    • Evaluate sera for:

      • Bactericidal activity against S. sonnei

      • Opsonophagocytic activity with human neutrophils

      • Adherence inhibition to epithelial cell lines

    • Compare results between YfbV-immunized animals and control groups

  • Animal immunization studies:

    • Design vaccine formulations containing:

      • Recombinant YfbV protein

      • YfbV combined with adjuvants (aluminum salts, MF59, etc.)

      • YfbV incorporated into outer membrane particles

    • Evaluate immune responses in appropriate animal models:

      • Measure antibody titers and isotype profiles

      • Assess T-cell responses through cytokine profiling

      • Challenge with virulent S. sonnei to assess protection

  • Cross-protection analysis:

    • Challenge immunized animals with different Shigella species

    • Analyze sequence conservation of YfbV across Shigella species

    • Assess cross-reactive antibody responses against heterologous strains

These protocols provide a comprehensive framework for evaluating YfbV's potential as a vaccine component against shigellosis.

How should researchers approach gene expression analysis of yfbV under different environmental conditions?

A comprehensive gene expression analysis of yfbV under varying environmental conditions should follow this methodological framework:

  • Condition selection: Select environmentally relevant conditions including:

    • Growth phase variations (lag, log, stationary)

    • pH variations (acidic conditions mimicking stomach, neutral conditions of intestine)

    • Oxygen levels (aerobic, microaerobic, anaerobic)

    • Nutrient availability (rich media, minimal media, iron-limited)

    • Bile salt concentrations

    • Temperature shifts (37°C human body, 25°C environment)

    • Exposure to epithelial cell lines (Caco-2, HT-29)

  • RNA extraction protocol:

    • Harvest Shigella sonnei cultures at predetermined timepoints

    • Stabilize RNA immediately using RNAprotect or TRIzol

    • Extract total RNA using specialized kits designed for Gram-negative bacteria

    • Verify RNA quality using Bioanalyzer (RIN > 8.0)

    • Remove genomic DNA contamination using DNase treatment

  • Expression quantification approaches:

    • RT-qPCR for targeted analysis:

      • Design primers specific to yfbV with efficiency between 90-110%

      • Validate multiple reference genes (rpoD, gyrA) under each condition

      • Calculate relative expression using 2^-ΔΔCt method

    • RNA-Seq for genome-wide context:

      • Prepare strand-specific libraries

      • Sequence to minimum depth of 10 million reads per sample

      • Map reads to Shigella sonnei reference genome

      • Normalize counts using appropriate methods (TPM, RPKM)

      • Identify co-regulated genes through cluster analysis

  • Data analysis framework:

    • Perform condition-pairwise comparisons with appropriate statistical tests

    • Construct expression heat maps across all conditions

    • Identify environmental triggers that significantly alter yfbV expression

    • Compare expression patterns with known virulence factors

    • Develop predictive models of regulation using machine learning approaches

  • Validation experiments:

    • Confirm key findings with protein-level analysis (Western blot)

    • Generate transcriptional reporter fusions (yfbV promoter-GFP)

    • Visualize expression in infection models using fluorescence microscopy

This approach will yield a comprehensive understanding of yfbV regulation under environmentally relevant conditions, potentially revealing its role in Shigella pathogenesis.

What are the common challenges in expressing and purifying recombinant YfbV protein, and how can they be addressed?

Membrane proteins like YfbV present several challenges during recombinant expression and purification. Here are the common issues and recommended solutions:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly due to toxicity or inefficient membrane insertion.

    • Solutions:

      • Use tightly controlled expression systems (e.g., pET with T7-lac promoter)

      • Reduce expression temperature to 16-20°C

      • Try specialized E. coli strains (C41/C43, Lemo21) designed for membrane proteins

      • Consider fusion partners (MBP, SUMO) to enhance solubility

      • Test expression in membrane-mimicking environments using cell-free systems

  • Protein misfolding and aggregation:

    • Challenge: Improper folding leading to inclusion body formation.

    • Solutions:

      • Optimize induction conditions (IPTG concentration 0.1-0.5 mM)

      • Co-express with chaperones (GroEL/ES, DnaK/J)

      • Test expression as truncated constructs focusing on soluble domains

      • For refolding from inclusion bodies, use gradual dialysis with decreasing denaturant concentrations

  • Inefficient extraction from membranes:

    • Challenge: Insufficient solubilization of membrane-embedded YfbV.

    • Solutions:

      • Screen multiple detergents systematically (DDM, LDAO, C12E8)

      • Optimize detergent concentration relative to protein concentration

      • Increase extraction time (overnight at 4°C with gentle rotation)

      • Consider detergent mixtures for enhanced extraction efficiency

  • Protein instability after purification:

    • Challenge: Rapid degradation or precipitation during storage.

    • Solutions:

      • Add glycerol (10-20%) to storage buffer

      • Include specific lipids that stabilize membrane proteins

      • Store at higher protein concentrations (>1 mg/mL)

      • Test different buffer compositions using thermal shift assays

      • Consider nanodiscs or amphipols for long-term stability

  • Low purity and contamination:

    • Challenge: Co-purification of contaminants or degradation products.

    • Solutions:

      • Implement multi-step purification strategy

      • Add specific protease inhibitors during cell lysis

      • Use size exclusion as final polishing step

      • Consider on-column refolding approaches for better selectivity

By implementing these solutions systematically and documenting outcomes, researchers can establish optimized protocols for recombinant YfbV production.

How can researchers verify the structural integrity and functionality of purified YfbV protein?

Verifying structural integrity and functionality of purified YfbV protein requires a multi-technique approach:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy:

      • Far-UV (190-260 nm) for secondary structure assessment

      • Near-UV (260-320 nm) for tertiary structure fingerprinting

      • Thermal unfolding to determine transition temperatures

    • Fluorescence spectroscopy:

      • Intrinsic tryptophan fluorescence to monitor folding status

      • Use 8-anilino-1-naphthalenesulfonic acid (ANS) binding to detect exposed hydrophobic regions

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS):

      • Determine oligomeric state and homogeneity

      • Calculate molecular weight independent of shape

      • Detect presence of aggregates or degradation products

  • Structural analysis:

    • Negative stain electron microscopy:

      • Visualize protein particles to confirm expected size and shape

      • Assess sample homogeneity and aggregation status

    • Limited proteolysis:

      • Expose protein to controlled protease digestion

      • Analyze fragments by mass spectrometry

      • Compare digestion pattern with in silico predictions based on structure

    • Hydrogen-deuterium exchange mass spectrometry:

      • Map solvent accessibility of different protein regions

      • Compare experimental data with structural predictions

  • Functional verification:

    • Binding assays:

      • Surface plasmon resonance against predicted ligands

      • Microscale thermophoresis for quantitative binding analysis

      • Develop a fluorescence-based binding assay for high-throughput screening

    • Cell-based functional assays:

      • Assess ability to bind epithelial cell lines

      • Compare activity with native YfbV in cellular context

      • Evaluate competitive inhibition of Shigella adhesion

    • Complementation studies:

      • Test if purified YfbV can restore phenotypes in ΔyfbV mutants

      • Develop assays measuring restoration of specific functions

  • Stability assessment:

    • Differential scanning calorimetry to determine thermal stability

    • Long-term storage tests at different temperatures (4°C, -20°C, -80°C)

    • Freeze-thaw stability through multiple cycles

    • Monitor activity retention over time with functional assays

This comprehensive verification approach ensures that purified YfbV maintains native-like properties necessary for meaningful structural and functional studies.

What are the most promising research directions for understanding YfbV's role in Shigella pathogenesis?

The most promising research directions for elucidating YfbV's role in Shigella pathogenesis include:

  • Structure-function relationship studies:

    • Determine the three-dimensional structure of YfbV using X-ray crystallography or cryo-electron microscopy

    • Identify functional domains through systematic mutagenesis and chimeric protein construction

    • Correlate structural features with binding specificities observed in glycan array studies

    • Map the topology of YfbV in the bacterial membrane using accessibility labeling

  • Host-pathogen interaction dynamics:

    • Track YfbV expression and localization during different stages of infection using fluorescent protein fusions

    • Identify host receptors that interact with YfbV through approaches like BioID proximity labeling

    • Develop live-cell imaging techniques to visualize YfbV-mediated adhesion in real-time

    • Compare YfbV-dependent adhesion mechanisms across different host cell types

  • Transcriptional regulation networks:

    • Map the regulatory elements controlling yfbV expression

    • Identify transcription factors that modulate yfbV expression under different environmental conditions

    • Determine if yfbV is part of known virulence regulons (VirF regulon, etc.)

    • Develop systems biology models predicting yfbV expression during infection

  • Cross-species comparative analysis:

    • Compare sequence conservation and functional characteristics of YfbV homologs across Shigella species

    • Examine evolutionary relationships between YfbV and related proteins in other Enterobacteriaceae

    • Identify species-specific adaptations in YfbV structure and function

    • Correlate YfbV variations with host range and tissue tropism differences

  • Vaccine development potential:

    • Assess conservation of YfbV epitopes across clinical isolates

    • Determine correlates of protection for anti-YfbV immune responses

    • Develop novel antigen presentation strategies for YfbV-based vaccines

    • Evaluate combination approaches with other Shigella antigens for synergistic protection

These research directions would significantly advance our understanding of YfbV's role in Shigella pathogenesis and potentially lead to new therapeutic and preventive strategies against shigellosis.

How might advances in structural biology techniques contribute to better understanding of YfbV function?

Advances in structural biology techniques offer transformative opportunities for understanding YfbV function:

  • Cryo-electron microscopy (cryo-EM) approaches:

    • Single-particle analysis can determine YfbV structure at near-atomic resolution without crystallization

    • Cryo-electron tomography can visualize YfbV in its native membrane environment

    • Time-resolved cryo-EM can potentially capture different conformational states during ligand binding

    • Correlative light and electron microscopy (CLEM) can connect YfbV localization with cellular ultrastructure

  • Integrative structural biology:

    • Combine multiple techniques (X-ray crystallography, NMR, SAXS, cryo-EM) to develop comprehensive structural models

    • Use computational approaches to integrate diverse experimental data

    • Apply molecular dynamics simulations to study YfbV dynamics in membranes

    • Predict conformational changes during host interaction using normal mode analysis

  • Advanced nuclear magnetic resonance (NMR) techniques:

    • Solid-state NMR can study membrane-embedded YfbV without extraction

    • TROSY-based solution NMR can determine structure of specific domains

    • Paramagnetic relaxation enhancement can map interactions with binding partners

    • Real-time NMR can capture transient structural changes during function

  • Mass spectrometry-based structural approaches:

    • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

    • Cross-linking mass spectrometry to identify intramolecular contacts

    • Native mass spectrometry to determine oligomeric states and binding stoichiometry

    • Ion mobility-mass spectrometry to assess conformational distributions

  • Emerging technologies:

    • Microcrystal electron diffraction (MicroED) for structure determination from nanocrystals

    • Serial femtosecond crystallography at X-ray free electron lasers for radiation-damage-free structures

    • In-cell structural studies using techniques like in-cell NMR

    • Cryo-focused ion beam milling combined with electron tomography to visualize YfbV in intact bacteria

These advanced structural biology approaches would reveal not only the static architecture of YfbV but also its dynamic behavior during interaction with host components, providing unprecedented insights into its functional mechanisms during Shigella pathogenesis.

What comparative genomics approaches could reveal evolutionary insights about YfbV across Shigella species?

Comparative genomics offers powerful approaches for understanding YfbV evolution across Shigella species:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenetic trees of YfbV sequences across:

      • All Shigella species and serotypes

      • Related Enterobacteriaceae including E. coli pathotypes

      • More distant bacterial families with homologous proteins

    • Apply multiple sequence alignment algorithms optimized for membrane proteins

    • Calculate evolutionary rates for different protein domains

    • Identify clade-specific sequence signatures

  • Selection pressure analysis:

    • Calculate dN/dS ratios across the YfbV sequence to identify:

      • Conserved regions under purifying selection (functional constraints)

      • Variable regions under positive selection (adaptation)

      • Neutrally evolving regions

    • Apply site-specific selection models to identify individual amino acids under selection

    • Compare selection patterns between membrane domains and extracellular domains

    • Correlate selection patterns with host adaptation events in Shigella evolution

  • Structural variation mapping:

    • Analyze insertion/deletion patterns across YfbV homologs

    • Identify recombination events that shaped YfbV evolution

    • Map structural variations onto predicted protein domains

    • Associate structural variations with functional differences

  • Genomic context analysis:

    • Examine conservation of genes flanking yfbV across species

    • Identify operon structures and co-evolved gene clusters

    • Detect horizontal gene transfer events through compositional bias analysis

    • Compare regulatory regions to identify conserved and divergent control elements

  • Population genomics approach:

    • Analyze yfbV sequence variation across clinical isolates of Shigella

    • Correlate specific variants with geographical distribution

    • Identify variants associated with outbreak strains or enhanced virulence

    • Track temporal changes in yfbV sequences in surveillance databases

These comparative genomics approaches would reveal how YfbV has evolved alongside Shigella speciation and host adaptation, potentially identifying key residues responsible for species-specific functions and illuminating the protein's role in Shigella pathogenesis from an evolutionary perspective.

How does YfbV research contribute to our understanding of bacterial membrane proteins in pathogenesis?

YfbV research provides several significant contributions to our broader understanding of membrane proteins in bacterial pathogenesis:

  • Advancement of membrane protein paradigms:

    • YfbV belongs to the UPF0208 protein family, which remains poorly characterized despite conservation across many bacterial species. Research on YfbV helps illuminate the functions of this entire protein family, potentially revealing new mechanisms of membrane protein function.

    • The dual roles of bacterial membrane proteins in cellular physiology and virulence are exemplified by YfbV, which likely contributes to both membrane integrity and host interactions, similar to YtfB that influences both cell division and adhesion .

    • YfbV research contributes to understanding how bacteria utilize membrane proteins as multifunctional molecules that can adapt to different environmental contexts during infection.

  • Host-pathogen interface insights:

    • Membrane proteins like YfbV represent the interface between pathogen and host, making them central to understanding the molecular dialogue during infection.

    • The potential glycan-binding properties of YfbV, similar to those observed with YtfB , illustrate how bacteria use membrane proteins to recognize specific host structures with remarkable specificity and affinity.

    • Understanding YfbV's role provides insights into how pathogens like Shigella target specific host tissues through receptor-ligand interactions mediated by surface proteins.

  • Evolutionary adaptation mechanisms:

    • Research on YfbV across Shigella species reveals how membrane proteins evolve alongside bacterial adaptation to specific host niches.

    • The conservation patterns of YfbV inform our understanding of essential membrane protein functions versus adaptable features that evolve during host specialization.

    • Comparative studies of YfbV with homologs in other Enterobacteriaceae illuminate convergent and divergent evolutionary paths in membrane protein development.

  • Technological advancement for membrane protein research:

    • The challenges in studying YfbV drive methodological innovations applicable to other membrane proteins.

    • Techniques optimized for YfbV expression, purification, and structural analysis contribute to the broader toolkit for membrane protein research.

    • Novel assays developed to study YfbV function can be adapted to investigate other bacterial membrane proteins.

YfbV research thus serves as a model system for understanding the multifaceted roles of bacterial membrane proteins in pathogenesis, from basic cellular functions to specific host interactions.

What interdisciplinary approaches might accelerate discoveries about YfbV function?

Accelerating discoveries about YfbV function requires innovative interdisciplinary approaches that integrate diverse scientific disciplines:

  • Systems biology integration:

    • Network analysis connecting YfbV to global protein interaction networks in Shigella

    • Multi-omics integration combining proteomics, transcriptomics, and metabolomics data

    • Mathematical modeling of YfbV's role in cellular processes

    • Development of predictive algorithms for YfbV functional interactions based on machine learning

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize YfbV localization during infection

    • Correlative light and electron microscopy to connect YfbV distribution with cellular ultrastructure

    • Live-cell imaging with genetically encoded sensors to track YfbV dynamics

    • Intravital microscopy to observe YfbV-dependent processes during in vivo infection

  • Synthetic biology approaches:

    • Creation of minimal membrane protein systems to isolate YfbV functions

    • Development of orthogonal expression systems for controlled YfbV studies

    • Engineering of reporter systems that link YfbV activity to measurable outputs

    • Design of synthetic binding partners to probe YfbV interaction specificity

  • Chemical biology techniques:

    • Activity-based protein profiling to identify YfbV functional states

    • Photo-crosslinking to capture transient protein-protein interactions

    • Click chemistry approaches to track YfbV modifications and trafficking

    • Small molecule screening to identify YfbV modulators or inhibitors

  • Biophysics and nanotechnology integration:

    • Single-molecule force spectroscopy to measure YfbV binding dynamics

    • Nanoscale thermophoresis for high-sensitivity interaction studies

    • Atomic force microscopy to visualize YfbV in native membrane environments

    • Nanoparticle-based sensors to detect YfbV-mediated changes in membrane properties

  • Computational approaches:

    • Molecular dynamics simulations of YfbV in membrane environments

    • Deep learning models to predict YfbV interactions from sequence data

    • Virtual screening for potential YfbV binding partners or inhibitors

    • Quantum mechanics calculations for detailed analysis of binding site interactions

By combining these interdisciplinary approaches, researchers can overcome the limitations of individual techniques and develop a comprehensive understanding of YfbV function across multiple scales, from atomic interactions to whole-organism pathogenesis.

How might YfbV research contribute to new therapeutic strategies against Shigella infections?

YfbV research has significant potential to contribute to novel therapeutic strategies against Shigella infections through multiple translational pathways:

  • Vaccine development applications:

    • YfbV could serve as a conserved antigen for subunit vaccine formulations against Shigella

    • Its membrane location makes it accessible to antibodies, increasing its vaccine potential

    • If YfbV shows limited antigenic variation across Shigella species, it might enable broad-spectrum protection

    • Structural studies of YfbV could guide epitope-focused vaccine design targeting the most immunogenic regions

  • Anti-virulence drug development:

    • If YfbV proves essential for adhesion or invasion, it becomes an attractive target for anti-virulence compounds

    • Small molecule inhibitors could be designed to:

      • Block YfbV binding to host receptors

      • Disrupt YfbV interactions with other bacterial proteins

      • Interfere with YfbV membrane insertion or folding

    • Virtual screening and structure-based drug design could accelerate inhibitor discovery once YfbV structure is determined

  • Diagnostic applications:

    • YfbV-specific antibodies could be developed for rapid immunodiagnostic tests

    • If YfbV shows species-specific variations, diagnostics could distinguish between Shigella species

    • Detection of anti-YfbV antibodies in patient sera might indicate recent Shigella infection

    • Monitoring YfbV expression in clinical isolates could provide insights into virulence potential

  • Innovative therapeutic approaches:

    • Glycan decoys mimicking YfbV binding targets could prevent bacterial adhesion

    • Engineered phages targeting YfbV-expressing bacteria might provide precise antimicrobial action

    • Nanoparticles functionalized with YfbV ligands could selectively deliver antimicrobials to Shigella

    • Immunotherapeutic approaches using anti-YfbV antibodies might enhance clearance of infection

  • Microbiome-based interventions:

    • Understanding how YfbV contributes to Shigella colonization amid commensal bacteria

    • Developing probiotic strains expressing competing adhesins to block YfbV-mediated attachment

    • Engineering commensal E. coli to express YfbV inhibitors as living therapeutics

    • Identifying microbiome signatures that reduce susceptibility to YfbV-mediated colonization

These diverse therapeutic applications highlight how fundamental research on YfbV can translate into practical interventions against Shigella infections, potentially addressing the growing concern of antimicrobial resistance in Shigella through target-specific approaches that complement traditional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.