Recombinant Shigella sonnei UPF0259 membrane protein yciC (yciC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
yciC; SSON_1911; UPF0259 membrane protein YciC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
yciC
Target Protein Sequence
MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGS SGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIG ASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGIFASMRSSM RLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFR LYMLIRQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant YciC protein preparations for experimental use?

For optimal stability and activity retention of recombinant Shigella sonnei UPF0259 membrane protein YciC, the following storage protocols are recommended:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Medium-term storage: Store at -20°C in a Tris-based buffer containing 50% glycerol

  • Long-term storage: Conserve at -80°C in the same buffer formulation

It is critically important to avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity and function. Researchers should prepare small working aliquots to minimize the need for multiple freeze-thaw events. The presence of 50% glycerol in the storage buffer serves as a cryoprotectant that helps maintain protein stability during freezing and thawing processes .

What is the significance of Shigella sonnei as an emerging pathogen in global health?

Shigella sonnei has emerged as a significant global pathogen with changing epidemiological patterns. It is now the second most common cause of shigellosis (bloody diarrhea) in low- and middle-income countries (LMICs) and the predominant species in developed nations . This shifting pattern from S. flexneri to S. sonnei dominance appears to be multifactorial, involving:

  • Improved sanitation leading to reduced cross-immunization from Plesiomonas shigelliodes (which shares the same O-antigen as S. sonnei)

  • Competitive advantage through encoding of type VI secretion system (T6SS)

  • Production of colicins and mucinases that eliminate phylogenetically related bacteria

  • Expression of virulence proteins like pic and SepA that destabilize host intestinal epithelial integrity

  • Acquisition of antimicrobial resistance genes, particularly through class II integrons

The growing concern about S. sonnei is amplified by its increasing resistance to first-line antibiotics, with ciprofloxacin and fluoroquinolone-resistant strains now widely distributed globally. Genomic studies have identified that this resistance often stems from a single clone with sequential mutations in gyrA and parC genes, which spread from South Asia to Southeast Asia and Europe .

How can researchers effectively express and purify recombinant Shigella sonnei UPF0259 membrane protein YciC for structural studies?

For high-yield expression and purification of recombinant Shigella sonnei UPF0259 membrane protein YciC, researchers should implement a multi-phase approach:

Expression System Selection:
Given the hydrophobic nature of YciC as a membrane protein, E. coli-based expression systems with specialized strains like C41(DE3) or C43(DE3) are recommended as they are engineered for membrane protein expression. Alternative systems include yeast (Pichia pastoris) for eukaryotic processing capabilities if needed.

Optimization Protocol:

  • Clone the full coding sequence (amino acids 1-247) into an expression vector with an appropriate tag (His-tag is commonly used)

  • Transform into the selected expression host

  • Optimize expression conditions through small-scale testing of:

    • Induction temperature (typically lower temperatures of 16-25°C improve membrane protein folding)

    • Inducer concentration

    • Duration of expression

    • Media composition (supplementation with glycerol may enhance membrane protein expression)

Purification Strategy:

  • Cell lysis using gentle detergents to solubilize membrane proteins

  • Initial purification via affinity chromatography using the fusion tag

  • Secondary purification via size exclusion chromatography

  • Detergent exchange if necessary for downstream applications

Quality Control Checkpoints:

  • SDS-PAGE and Western blotting to confirm protein identity and purity

  • Circular dichroism to verify secondary structure integrity

  • Dynamic light scattering to assess aggregation state

  • Activity assays if applicable

This methodological approach ensures production of high-quality recombinant protein suitable for structural and functional studies while addressing the typical challenges associated with membrane protein expression and purification.

What immune responses are elicited by Shigella sonnei membrane proteins in controlled human infection models?

Controlled human infection models (CHIMs) with Shigella sonnei provide valuable insights into immune responses against membrane proteins, though specific data on YciC responses are not detailed in the available literature. The broader immune response patterns observed in these models include:

Intestinal Inflammatory Responses:
Infection with S. sonnei 53G induces robust intestinal inflammation characterized by:

  • Increased production of pro-inflammatory cytokines

  • Neutrophil recruitment to intestinal tissues

  • Elevated fecal inflammatory markers

Antibody Response Profile:
The humoral immune response following S. sonnei infection demonstrates:

  • Antigen-specific antibodies in both serum and mucosal secretions

  • Development of LPS-specific serum IgA and IgG

  • Production of functional antibodies with neutralizing capacity

Cellular Immune Response:
CHIMs have revealed important aspects of cellular immunity:

  • Generation of antigen-specific IgA- and IgG-secreting B cells expressing the α4β7 gut-homing marker

  • Development of memory B cell responses specific to S. sonnei antigens

  • Higher LPS-specific serum IgA and IgA-secreting memory B cell responses correlate with reduced risk of disease following challenge

These findings offer valuable guidance for researchers developing vaccines targeting S. sonnei membrane proteins, indicating that stimulating both mucosal and systemic immunity may be necessary for effective protection.

How can recombinant YciC protein be utilized in vaccine development strategies against Shigella sonnei?

Leveraging recombinant Shigella sonnei UPF0259 membrane protein YciC in vaccine development requires a strategic approach based on current understanding of S. sonnei immunology and vaccine technology:

Potential Vaccine Platforms:

Platform TypeAdvantagesConsiderations for YciC Incorporation
Subunit VaccinesHigh safety profile; precise antigen deliveryRequires appropriate adjuvants; may need combination with other antigens
Live-Attenuated VectorsMimics natural infection; stimulates mucosal immunityMust maintain YciC native conformation; immunodominance concerns
Outer Membrane Vesicles (OMVs)Presents antigens in native conformation; multiple antigens simultaneouslyPurification complexity; potential reactogenicity
mRNA VaccinesRapid development; intracellular expressionDelivery system optimization; stability concerns

Immunological Considerations:
While YciC-specific immune responses aren't detailed in the available literature, effective S. sonnei vaccines should stimulate:

  • Strong mucosal IgA responses - critical for preventing initial infection

  • Memory B cell development with gut-homing properties (α4β7+)

  • Balanced Th1/Th17 responses for cell-mediated immunity

Combinatorial Approach:
Evidence suggests that membrane proteins alone may not provide complete protection. Research indicates that IpaB and IpaD proteins from S. sonnei have shown promise as vaccine candidates in mouse models . Therefore, a multi-antigen approach combining YciC with:

  • LPS antigens (O-antigen specific)

  • Invasion plasmid antigens (IpaB, IpaD)

  • Conserved outer membrane proteins

may provide broader protection against diverse S. sonnei strains, including emerging antibiotic-resistant variants.

Evaluation Strategy:
Vaccine candidates incorporating YciC should be evaluated through:

  • In vitro assessment of antibody responses

  • Animal models measuring protection against challenge

  • Controlled human infection models (CHIMs) to assess safety and immunogenicity

  • Monitoring of both systemic and mucosal immune responses

This methodological framework provides a rational approach to incorporating YciC into next-generation vaccine strategies against the growing global threat of S. sonnei infections.

What analytical techniques are most effective for characterizing the interaction of YciC with host cell membranes?

To effectively characterize the interactions between recombinant Shigella sonnei UPF0259 membrane protein YciC and host cell membranes, researchers should employ a multi-technique approach:

Biophysical Techniques:

  • Surface Plasmon Resonance (SPR)

    • Provides real-time, label-free measurement of binding kinetics between YciC and membrane components

    • Enables determination of association/dissociation constants (ka, kd, KD)

    • Can be adapted to use liposomes or membrane mimics as the immobilized phase

  • Microscale Thermophoresis (MST)

    • Measures binding interactions based on changes in thermophoretic mobility

    • Requires minimal sample amounts

    • Works well with membrane proteins in detergent micelles

  • Fluorescence-based Techniques

    • Förster Resonance Energy Transfer (FRET) to measure proximity between YciC and membrane components

    • Fluorescence Recovery After Photobleaching (FRAP) to assess mobility within membranes

    • Fluorescence Correlation Spectroscopy (FCS) for single-molecule diffusion analysis

Structural Analysis Methods:

  • Cryo-Electron Microscopy

    • Visualizes YciC insertion into lipid bilayers

    • Can capture different conformational states

    • Provides near-atomic resolution of membrane protein complexes

  • Atomic Force Microscopy (AFM)

    • Measures topography of YciC within membranes

    • Enables force measurements of membrane interactions

    • Can be performed under physiological conditions

Cellular and Molecular Approaches:

  • Cell-Based Assays

    • Fluorescently labeled YciC to track localization during host cell interaction

    • Membrane fractionation studies to identify host compartment localization

    • Co-immunoprecipitation to identify host binding partners

  • Lipidomics Analysis

    • Mass spectrometry to identify specific lipid interactions

    • Lipid overlay assays to screen for binding preferences

    • Monolayer insertion studies to measure penetration capabilities

Each technique provides complementary information about different aspects of YciC-membrane interactions. By combining multiple approaches, researchers can develop a comprehensive understanding of how this membrane protein may contribute to Shigella sonnei pathogenesis through its interaction with host cell membranes.

What are the most reliable protocols for assessing YciC protein function in vitro?

Reliable assessment of Shigella sonnei UPF0259 membrane protein YciC function requires carefully designed in vitro protocols that account for its membrane-associated nature:

Membrane Protein Reconstitution Systems:

  • Proteoliposome Preparation:

    • Reconstitute purified YciC into liposomes of defined lipid composition

    • Typical lipid mixture: POPC, POPE, POPG at ratios mimicking bacterial membranes

    • Incorporate using detergent-mediated reconstitution followed by detergent removal via dialysis or bio-beads

  • Nanodiscs Assembly:

    • Incorporate YciC into nanodiscs using membrane scaffold proteins (MSPs)

    • Allows for more controlled lipid environment and increased stability

    • Enables study of both sides of the membrane protein

Functional Characterization Assays:

  • Permeability Studies:

    • Fluorescent dye leakage assays to assess membrane integrity

    • Ion flux measurements using ion-sensitive fluorescent probes

    • Patch-clamp electrophysiology if channel activity is suspected

  • Protein-Protein Interaction Analysis:

    • Pull-down assays with potential interaction partners

    • Biolayer interferometry for kinetic measurements

    • Crosslinking mass spectrometry to identify interaction interfaces

  • Membrane Dynamics Assessment:

    • Differential scanning calorimetry to measure effects on membrane phase transitions

    • Nuclear magnetic resonance (NMR) to analyze lipid ordering

    • Fluorescence anisotropy to measure membrane fluidity changes

Quality Control Measures:
To ensure reliable results, implement these critical controls:

  • Confirm proper protein orientation in reconstituted systems using protease protection assays

  • Verify protein stability using circular dichroism before and after reconstitution

  • Include non-functional mutants as negative controls

  • Use related bacterial membrane proteins as comparative controls

This methodological framework provides a comprehensive approach to investigating YciC function while addressing the technical challenges inherent to membrane protein studies.

How can researchers accurately measure the contribution of YciC to Shigella sonnei pathogenesis in animal models?

To accurately measure the contribution of YciC to Shigella sonnei pathogenesis, researchers should implement a systematic approach using complementary animal models and precise analytical methods:

Genetic Manipulation Strategies:

  • CRISPR-Cas9 Gene Editing:

    • Generate clean yciC deletion mutants in S. sonnei

    • Create point mutations in functional domains

    • Develop complemented strains with wild-type yciC for validation

  • Controlled Expression Systems:

    • Implement inducible promoters to regulate YciC expression levels

    • Create reporter fusions to monitor expression during infection

    • Develop tagged versions that maintain function for in vivo tracking

Animal Model Selection:

ModelAdvantagesLimitationsKey Measurements
Mouse intestinal infectionMammalian physiology; well-characterized immune systemRequires antibiotic pretreatment; lower bacterial loads than humansColonization levels; histopathology; immune response
Guinea pig keratoconjunctivitisNatural susceptibility; clear disease symptomsLimited to ocular pathogenesisDisease progression; bacterial replication; inflammatory markers
Infant rabbit modelNatural susceptibility; intestinal pathology similar to humansHandling challenges; specialized facilities neededDiarrhea; weight loss; bacterial shedding; tissue pathology

Analytical Methods:

  • Bacterial Burden Assessment:

    • Quantitative culture from intestinal segments

    • In vivo bioluminescence imaging with luciferase-expressing strains

    • Fluorescence microscopy of tissue sections to visualize bacterial localization

  • Host Response Measurements:

    • Histopathological scoring of tissue damage

    • Cytokine/chemokine profiling from tissue homogenates

    • Flow cytometry to characterize immune cell infiltration

    • RNA-seq analysis of host transcriptional responses

  • Competitive Index Studies:

    • Co-infection with wild-type and YciC-deficient strains

    • Calculation of competitive index to quantify fitness differences

    • In vivo passage experiments to assess evolutionary pressure

  • Trans-complementation Analysis:

    • Rescue experiments with purified YciC protein

    • Conditional expression systems to determine timing of YciC requirement

    • Cross-species complementation to assess functional conservation

This comprehensive approach enables researchers to precisely quantify YciC's contribution to virulence while controlling for experimental variables that could confound interpretation of results.

What bioinformatic approaches can predict functional domains and evolutionary significance of YciC?

Comprehensive bioinformatic analysis of Shigella sonnei UPF0259 membrane protein YciC can reveal crucial insights into its functional domains and evolutionary significance using the following methodological approaches:

Sequence-Based Analysis:

  • Multiple Sequence Alignment (MSA):

    • Align YciC with homologs from diverse bacterial species

    • Identify conserved residues suggesting functional importance

    • Detect lineage-specific conservation patterns

    • Tools: MUSCLE, MAFFT, or T-Coffee with visualization in Jalview

  • Domain Architecture Prediction:

    • Scan for known domains using InterPro, Pfam, and SMART databases

    • Identify transmembrane regions using TMHMM, TOPCONS

    • Predict signal peptides using SignalP

    • Locate potential binding sites using ConSurf

  • Phylogenetic Analysis:

    • Construct maximum likelihood or Bayesian phylogenetic trees

    • Analyze co-evolution with other virulence factors

    • Assess selection pressure using dN/dS ratio calculations

    • Tools: RAxML, MrBayes, PAML

Structural Bioinformatics:

  • Homology Modeling:

    • Generate 3D structural models using I-TASSER, Phyre2, or AlphaFold2

    • Validate models using PROCHECK, VERIFY3D

    • Refine models using molecular dynamics simulations

  • Molecular Dynamics Simulations:

    • Simulate behavior in membrane environments

    • Identify stable conformational states

    • Analyze flexibility and potential conformational changes

    • Tools: GROMACS, NAMD, AMBER

  • Binding Site Prediction:

    • Identify potential ligand binding pockets using CASTp, fpocket

    • Predict protein-protein interaction sites using SPPIDER, WHISCY

    • Model docking with potential interaction partners using HADDOCK, ClusPro

Functional Inference:

  • Network Analysis:

    • Construct protein-protein interaction networks

    • Identify functional modules through co-expression analysis

    • Perform gene neighborhood analysis across bacterial genomes

    • Tools: STRING, Cytoscape, GeneMANIA

  • Genomic Context Analysis:

    • Examine conservation of genomic organization around yciC

    • Detect operonic structures suggesting functional relationships

    • Identify horizontally transferred regions

    • Tools: MicrobesOnline, MaGe, DOOR2

  • Machine Learning Approaches:

    • Train classifiers on known membrane protein functions

    • Apply feature extraction methods to predict functional properties

    • Use deep learning to integrate multiple data types

    • Tools: DeepFold, DeepGOPlus

This systematic bioinformatic workflow provides a robust framework for generating testable hypotheses about YciC function, evolutionary history, and potential role in Shigella sonnei pathogenesis, guiding subsequent experimental investigations.

How should researchers design experiments to investigate potential interactions between YciC and the host immune system?

Designing robust experiments to investigate interactions between Shigella sonnei UPF0259 membrane protein YciC and the host immune system requires a systematic approach spanning multiple experimental systems:

In vitro Immune Cell Interaction Studies:

  • Dendritic Cell Activation Assays:

    • Expose human monocyte-derived dendritic cells to purified YciC

    • Measure upregulation of activation markers (CD80, CD86, HLA-DR)

    • Quantify cytokine production (IL-12, TNF-α, IL-10)

    • Compare responses to known TLR agonists as positive controls

  • Macrophage Response Assays:

    • Challenge THP-1 derived macrophages with YciC protein

    • Assess phagocytosis, respiratory burst, and inflammasome activation

    • Measure pro-inflammatory cytokine production

    • Evaluate transcriptional responses using NF-κB reporter systems

  • T-cell Stimulation Experiments:

    • Pulse dendritic cells with YciC and co-culture with naïve T cells

    • Analyze T cell proliferation and subset differentiation (Th1/Th2/Th17)

    • Determine memory T cell generation

    • Compare with known S. sonnei antigens like IpaB and IpaD

Pattern Recognition Receptor (PRR) Screening:

  • TLR Activation Panel:

    • Test YciC with HEK293 cells expressing individual TLRs (TLR1-9)

    • Measure activation using NF-κB reporter assays

    • Confirm findings with TLR knockout models

    • Identify specific domains responsible through truncation mutants

  • Cytosolic Sensor Activation:

    • Assess activation of NOD1/2, RIG-I, and other cytosolic sensors

    • Use reporter cell lines and knockout validation

    • Determine if YciC gains access to cytosolic compartments

Ex vivo and In vivo Approaches:

  • Human Intestinal Organoid Studies:

    • Challenge intestinal organoids with YciC protein

    • Measure epithelial barrier function and antimicrobial peptide production

    • Assess mucosal immune responses

    • Use CRISPR-engineered organoids to identify host factors

  • Animal Model Immunological Profiling:

    • Compare immune responses to wild-type vs. YciC-deficient S. sonnei

    • Analyze tissue-specific immune cell infiltration

    • Perform adoptive transfer experiments to identify protective cell types

    • Use transgenic reporter mice to track immune activation in real-time

  • Controlled Human Infection Models (CHIM):

    • Measure YciC-specific antibody responses following challenge

    • Analyze correlation with protection from disease

    • Assess memory B cell responses with gut-homing markers

    • Compare to responses against other membrane proteins

This experimental framework enables comprehensive characterization of YciC's interactions with the immune system, from molecular recognition to adaptive immune responses, providing insights that could inform vaccine development strategies.

What are the key considerations when designing ELISA and other immunoassays for detecting antibodies against YciC?

Designing robust immunoassays for detecting antibodies against Shigella sonnei UPF0259 membrane protein YciC requires careful consideration of several technical aspects to ensure specificity, sensitivity, and reproducibility:

Antigen Preparation Considerations:

  • Protein Conformation:

    • Membrane proteins like YciC present special challenges due to their hydrophobic regions

    • Consider using:

      • Full-length protein in detergent micelles or nanodiscs

      • Selected hydrophilic domains as recombinant fragments

      • Synthetic peptides representing immunogenic epitopes

    • Validate proper folding using circular dichroism or other structural techniques

  • Immobilization Strategy:

    • Direct coating may cause denaturation of membrane proteins

    • Alternative approaches:

      • Capture via affinity tags (His, GST) on specially treated surfaces

      • Biotinylation and streptavidin-mediated capture

      • Presentation in liposomal formulations

ELISA Protocol Optimization:

  • Blocking Optimization:

    • Test multiple blocking agents (BSA, casein, commercial blockers)

    • Evaluate background signal with pre-immune sera

    • Consider specialized blockers for membrane protein work

  • Detection System Selection:

    • For human samples: Anti-human IgG, IgA, and IgM secondary antibodies

    • For mucosal samples: Special considerations for IgA detection

    • Signal amplification options: Avidin-biotin systems, polymeric detection reagents

  • Validation Controls:

    • Positive controls: Sera from known S. sonnei-infected subjects

    • Negative controls: Pre-immune sera and samples from non-exposed individuals

    • Competitive inhibition assays to confirm specificity

Alternative Immunoassay Platforms:

Assay TypeAdvantagesLimitationsSpecial Considerations for YciC
Multiplex Bead ArraysMultiple antigens tested simultaneously; small sample volumeComplex optimization; equipment costsMaintain native conformation during coupling
Western BlotConfirms specificity by molecular weight; detects linear epitopesLower throughput; semi-quantitativeDenaturation may expose or destroy epitopes
Flow CytometrySingle-cell resolution; multiplex capabilityTechnical complexity; equipment costsCan present YciC on beads or cell surfaces
Lateral FlowPoint-of-care potential; rapid resultsLimited sensitivity; qualitativeRequires highly specific antibody pairs

Data Analysis and Interpretation:

  • Quantification Approach:

    • Establish standard curves using reference antibodies if available

    • Consider reporting results as:

      • Endpoint titers

      • Optical density ratios to reference samples

      • Arbitrary units based on standard curves

  • Threshold Determination:

    • ROC curve analysis to establish optimal cutoffs

    • Use population-based approaches with known negative and positive samples

    • Consider bayesian approaches for low-prevalence settings

This comprehensive approach addresses the specific challenges of developing immunoassays for a membrane protein like YciC while ensuring scientific rigor and reliability of results.

How should researchers interpret conflicting experimental results regarding YciC function?

When researchers encounter conflicting experimental results regarding Shigella sonnei UPF0259 membrane protein YciC function, a systematic approach to data interpretation is essential to resolve discrepancies and advance understanding:

Methodological Analysis Framework:

  • Experimental System Variation:

    • Compare the experimental systems used (in vitro, ex vivo, in vivo)

    • Assess differences in:

      • Protein preparation methods (tags, purification approaches)

      • Expression systems (bacterial, mammalian, cell-free)

      • Buffer compositions and detergents

      • Host cell types or animal models

  • Technical Parameter Evaluation:

    • Analyze key experimental parameters:

      • Protein concentration ranges tested

      • Incubation times and temperatures

      • Detection methods and their sensitivity limits

      • Statistical analysis approaches

  • Biological Context Assessment:

    • Consider strain-specific variations in YciC sequence/structure

    • Evaluate potential post-translational modifications

    • Assess presence/absence of binding partners or cofactors

    • Examine microenvironmental conditions (pH, ionic strength)

Reconciliation Strategies:

  • Direct Replication Studies:

    • Design experiments that directly compare methods side-by-side

    • Implement standardized protocols across laboratories

    • Use identical reagents and materials when possible

    • Consider blinded analysis to minimize bias

  • Integrative Experimental Approaches:

    • Employ orthogonal techniques to address the same question

    • Develop assays with internal validation controls

    • Use dose-response studies to identify threshold effects

    • Implement time-course analyses to capture dynamic behaviors

  • Computational Integration:

    • Apply meta-analysis techniques to quantitatively compare results

    • Develop mathematical models that might explain apparently contradictory findings

    • Use machine learning to identify patterns across diverse datasets

Case Study Resolution Example:

Consider contradictory findings regarding YciC's role in antimicrobial resistance:

StudyFindingExperimental SystemPotential Explanation for Discrepancy
Study AYciC deletion reduces antibiotic resistanceClinical isolate; MIC determinationStrain-specific genetic background; compensatory mutations
Study BNo change in resistance with YciC knockoutLaboratory reference strain; Disk diffusionDifferent methodology; potential redundant systems
Study CYciC overexpression increases resistanceHeterologous expression; Growth curvesNon-physiological expression levels; artificial system

Resolution Approach:

  • Compare genetic backgrounds of strains used

  • Standardize resistance measurement methodology

  • Test multiple antibiotics with different mechanisms

  • Examine YciC expression levels in each system

  • Investigate potential interacting partners present/absent in different strains

This structured approach to interpreting conflicting data transforms discrepancies from obstacles into opportunities for deeper understanding of YciC function, potentially revealing context-dependent behaviors or previously unrecognized regulatory mechanisms.

What statistical approaches are most appropriate for analyzing immune responses to YciC in clinical samples?

Study Design Considerations:

  • Sample Size Determination:

    • Power analysis based on expected effect sizes from preliminary data

    • Consider variance estimates from similar immunological studies

    • Account for potential subgroup analyses and multiple testing

    • Plan for potential dropouts in longitudinal studies

  • Control Selection:

    • Age and sex-matched healthy controls

    • Disease controls (other enteric infections)

    • Pre-exposure baseline samples where available

    • Consider matched designs to control for confounding variables

Primary Analysis Approaches:

  • Parametric vs. Non-parametric Methods:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • For normally distributed data: t-tests, ANOVA, linear regression

    • For non-normal distributions: Mann-Whitney U, Kruskal-Wallis, Spearman correlation

    • Consider data transformations (log, square root) to achieve normality

  • Paired vs. Unpaired Analyses:

    • Paired tests for before-after comparisons (Wilcoxon signed-rank, paired t-test)

    • Repeated measures ANOVA for multiple timepoints

    • Mixed-effects models for longitudinal data with missing timepoints

  • Multivariate Approaches:

    • Principal Component Analysis (PCA) to identify patterns across multiple immune parameters

    • Hierarchical clustering to identify patient subgroups with similar response profiles

    • Partial Least Squares Discriminant Analysis (PLS-DA) to identify immune signatures associated with outcomes

Advanced Statistical Methods:

  • Controlling for Multiple Comparisons:

    • Bonferroni correction for conservative approach

    • False Discovery Rate (FDR) methods (Benjamini-Hochberg)

    • Familywise error rate control methods (Holm's sequential procedure)

  • Correlation with Clinical Outcomes:

    • Logistic regression for binary outcomes (protection vs. infection)

    • Cox proportional hazards for time-to-event data

    • ROC curve analysis to assess predictive value of immune markers

  • Machine Learning Integration:

    • Random forests for feature importance ranking

    • Support Vector Machines for outcome prediction

    • Cross-validation to assess model stability

Presentation of Statistical Results:

Data TypeRecommended VisualizationStatistical Reporting
Antibody titersBox plots with individual data pointsMedian with interquartile range; p-values with test name
CorrelationsScatter plots with regression linesCorrelation coefficient, confidence intervals, p-values
Categorical outcomesForest plots for odds ratiosEffect sizes with confidence intervals
Longitudinal dataLine graphs with error bandsMixed model parameters with standard errors

This comprehensive statistical framework ensures robust analysis of immune responses to YciC, accounting for the biological variability inherent in clinical samples while maximizing the information extracted from valuable patient specimens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.