Recombinant Shigella sonnei UPF0283 membrane protein YcjF (ycjF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ycjF; SSON_1817; UPF0283 membrane protein YcjF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
ycjF
Target Protein Sequence
MTEPLKPRIDFDGPLEVDQNPKFRAQQTFDENQAQNFAPATLDEAPEEEGQVEAVMDAAL RPKRSLWRKMVMGGLALFGASVVGQGVQWTMNAWQTQDWVALGGCAAGALIIGAGVGSVV TEWQCLWCLRQRAHERDEARDLLHSHGTGKGRAFCEKLAQQAGIDQSHPALQRWYASIHE TQNDREVVSLYAHLVQPVLDAQARREISRSAAESTLMIAVSPLALVDMAFIAWRNLRLIN RIATLYGIELGYYSRLRLFKLVLLNIAFAGASELVREVGMDWMSQDLAARLSTRAAQGIG AGLLTARLGIKAMELCRPLPWIDDDKPRLGDFRRQLIGQVKETLQKGKTPSEK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Shigella sonnei UPF0283 membrane protein YcjF and what is its significance in bacterial research?

Shigella sonnei UPF0283 membrane protein YcjF is a 353-amino acid membrane-associated protein expressed in S. sonnei. It belongs to the UPF0283 family of proteins, which are conserved across various bacterial species including closely related Enterobacteriaceae. The protein is encoded by the ycjF gene and represents a relatively understudied component of the S. sonnei membrane proteome .

The significance of this protein lies in its potential contribution to S. sonnei pathogenesis. S. sonnei has been increasingly recognized as a major cause of diarrheal disease globally and is progressively displacing S. flexneri as the dominant Shigella species, particularly in countries undergoing socioeconomic development . Understanding the functions of membrane proteins like YcjF could provide insights into this epidemiological shift and potentially reveal new targets for therapeutic interventions.

Additionally, recent transcriptomic studies have shown that S. sonnei exhibits distinct gene expression patterns compared to S. flexneri during infection, particularly in genes related to biofilm formation and acid resistance, suggesting species-specific adaptations that might involve membrane proteins like YcjF .

What are the optimal storage and handling conditions for recombinant YcjF protein preparations?

For maintaining structural and functional integrity of recombinant Shigella sonnei YcjF protein, the following storage and handling conditions are recommended:

  • Buffer composition: Tris-based buffer supplemented with 50% glycerol, specifically optimized for YcjF protein stability .

  • Primary storage temperature: -20°C for routine storage .

  • Long-term storage: For extended storage periods, maintain at -20°C or preferably at -80°C to minimize degradation .

  • Working conditions: Working aliquots may be stored at 4°C for up to one week to avoid repeated freeze-thaw cycles .

  • Freeze-thaw considerations: Repeated freezing and thawing is strongly discouraged as it can lead to protein denaturation and loss of functional activity .

  • Aliquoting strategy: Upon receipt of the protein, it is advisable to create small single-use aliquots before freezing to avoid multiple freeze-thaw cycles.

  • Quality control: Before experimental use, protein integrity can be verified by SDS-PAGE analysis.

These storage recommendations maximize stability while preserving the structural and functional characteristics of the recombinant protein for research applications.

What expression systems are suitable for producing recombinant Shigella sonnei YcjF protein?

Several expression systems can be employed for producing recombinant Shigella sonnei YcjF protein, each with distinct advantages depending on research requirements:

  • E. coli expression systems: The most commonly used approach for bacterial protein production. For YcjF, an E. coli system offers the advantage of native-like post-translational processing and high yield. Expression vectors containing T7 or tac promoters with appropriate affinity tags (His, GST, or MBP) facilitate purification .

  • Yeast expression systems: For studies requiring eukaryotic processing but with higher yields than mammalian systems. Pichia pastoris or Saccharomyces cerevisiae can be suitable alternatives when E. coli expression results in inclusion bodies .

  • Baculovirus expression systems: Intermediate between bacterial and mammalian systems, providing some eukaryotic post-translational modifications with higher yields than mammalian cells .

  • Mammalian cell expression systems: Rarely needed for bacterial proteins but may be considered for specific applications requiring mammalian-specific modifications or when studying host-pathogen interactions .

For membrane proteins like YcjF, special considerations include:

  • Use of specialized E. coli strains (C41, C43) designed for membrane protein expression

  • Codon optimization for the expression host

  • Temperature optimization (often lower temperatures improve folding)

  • Addition of specific chaperones or fusion partners to enhance solubility

The choice of expression system should be guided by the intended research application, required protein yield, and whether native conformation is critical for the planned experiments.

What is known about the general characteristics of the UPF0283 protein family to which YcjF belongs?

The UPF0283 protein family, to which YcjF belongs, remains relatively uncharacterized but exhibits several notable features:

  • Membrane association: Members of this family are typically inner membrane proteins with multiple predicted transmembrane domains. In E. coli, YcjF is classified as an inner membrane protein .

  • Structural conservation: Despite limited functional characterization, the protein family shows sequence conservation across diverse bacterial species, suggesting important cellular functions.

  • Domain architecture: The protein contains hydrophobic regions consistent with membrane insertion, though specific functional domains remain poorly defined.

  • Bacterial distribution: The UPF0283 family appears broadly distributed among Gram-negative bacteria, particularly within Enterobacteriaceae.

  • Expression patterns: In E. coli, the ycjF gene has been shown to be differentially expressed under various environmental conditions, with possible connections to stress responses .

  • Genomic context: Analysis of genomic organization across species may provide clues to function, as genes in the same operon often participate in related cellular processes.

  • Potential role in membrane organization: Based on properties of other membrane proteins, UPF0283 family members may contribute to membrane integrity, transport processes, or signal transduction.

While specific functions remain elusive, the conservation of this protein family across bacterial species suggests important roles that warrant further investigation, particularly in pathogens like Shigella sonnei where they may contribute to virulence or environmental adaptation.

What experimental approaches can be utilized to elucidate the function of YcjF in Shigella sonnei pathogenesis?

Elucidating the function of YcjF in Shigella sonnei pathogenesis requires a multi-faceted experimental approach combining genetic, molecular, and infection biology techniques:

  • Genetic manipulation strategies:

    • Generate precise ycjF deletion mutants using CRISPR-Cas9 or homologous recombination

    • Create complemented strains expressing wild-type or mutated versions of YcjF

    • Develop conditional expression systems to study essential functions

    • Construct reporter fusions (YcjF-GFP) to monitor expression and localization

  • Transcriptomic and proteomic analyses:

    • Apply dual RNA-seq to simultaneously analyze host and pathogen responses during infection, as demonstrated in C. elegans infection models

    • Compare proteomes of wild-type versus ΔycjF mutants under infection-relevant conditions

    • Analyze temporal expression patterns at early (10 minutes) and late (24 hours) infection timepoints

    • Identify genes co-regulated with ycjF to infer functional associations

  • Protein interaction studies:

    • Perform membrane protein pull-down experiments to identify interaction partners

    • Apply FRET microscopy to validate protein-protein interactions in vivo

    • Use bacterial two-hybrid systems modified for membrane proteins

    • Employ cross-linking mass spectrometry to capture transient interactions

  • Infection models:

    • Utilize the Caenorhabditis elegans infection model to assess pathogenicity of ΔycjF mutants

    • Employ tissue culture invasion assays with human intestinal epithelial cells

    • Consider guinea pig Sereny tests to evaluate in vivo virulence

    • Assess colonization dynamics in mouse intestinal models

  • Phenotypic characterization:

    • Evaluate biofilm formation capabilities, which are upregulated in S. sonnei during infection

    • Test acid resistance, which shows differential regulation between Shigella species

    • Assess membrane integrity, stress responses, and environmental adaptation

By integrating these approaches, researchers can systematically characterize YcjF's role in S. sonnei pathogenesis, particularly in the context of species-specific adaptations that may contribute to S. sonnei's increasing global prevalence.

How does YcjF contribute to the differential virulence and adaptation between Shigella sonnei and Shigella flexneri?

The differential virulence and adaptation between Shigella sonnei and Shigella flexneri may be partially attributed to membrane proteins like YcjF through several mechanisms, which can be investigated using comparative approaches:

  • Comparative transcriptomics during infection:

    • Dual RNA-seq studies have revealed that S. sonnei and S. flexneri exhibit distinct transcriptomic profiles during infection

    • S. sonnei specifically upregulates biofilm formation genes and energy generation/conservation pathways during in vivo growth

    • S. sonnei significantly upregulates acid resistance-related genes compared to S. flexneri during infection

    • YcjF may be differentially regulated between these species, contributing to these expression differences

  • Species-specific protein functions:

    • The amino acid sequence differences between S. sonnei and S. flexneri YcjF (particularly at positions 95-97) may confer distinct functional properties

    • These differences could affect:

      • Protein-protein interactions within bacterial membrane complexes

      • Interactions with host cell components

      • Contribution to membrane integrity under various environmental conditions

  • Host response modulation:

    • S. sonnei infection specifically leads to downregulation of sphingolipid metabolism in host organisms, unlike S. flexneri

    • As a membrane protein, YcjF may directly or indirectly contribute to this species-specific host response modulation

    • The differential ability to modulate host responses could influence pathogenesis and adaptation to different host environments

  • Environmental adaptation:

    • S. sonnei's increasing prevalence in developing countries undergoing improved water sanitation has been documented

    • YcjF may contribute to S. sonnei's adaptation to changing environmental conditions, potentially explaining its expanding global footprint

    • Differential expression or function of YcjF might affect survival in various water sources, resistance to disinfectants, or persistence outside hosts

To definitively establish YcjF's role in these differences, isogenic mutants lacking ycjF in both species should be characterized under identical conditions, focusing on biofilm formation, acid resistance, and host response modulation - key differences identified between these Shigella species .

How can structural biology approaches be optimized to determine the three-dimensional structure of membrane-associated YcjF?

Determining the three-dimensional structure of membrane-associated proteins like YcjF presents unique challenges requiring specialized approaches:

  • X-ray crystallography optimization:

    • Protein engineering: Create fusion constructs with crystallization chaperones (T4 lysozyme, BRIL) to increase soluble domains

    • Detergent screening: Systematically test detergents (DDM, LMNG, UDM) for optimal extraction while maintaining native conformation

    • Lipidic cubic phase (LCP) crystallization: Employ this method specifically designed for membrane proteins, which provides a more native-like environment

    • Antibody fragment co-crystallization: Use Fab/nanobody fragments to increase polar surface area and facilitate crystal contacts

  • Cryo-electron microscopy (cryo-EM) approaches:

    • Sample preparation optimization: Test various reconstitution methods (nanodiscs, amphipols, detergent micelles)

    • Particle enhancement: Use specific antibodies or protein engineering to increase particle size/asymmetry

    • Data collection strategy: Employ tilted data collection to overcome preferred orientation issues common with membrane proteins

    • Classification strategies: Implement 3D classification to separate different conformational states

  • NMR spectroscopy for specific domains:

    • Selective isotopic labeling: Employ selective labeling schemes for specific regions of interest

    • Soluble domain analysis: Express and analyze soluble domains separately

    • Solid-state NMR: Apply solid-state NMR techniques for full-length protein in membrane mimetics

  • Integrative structural biology:

    • Cross-linking mass spectrometry (XL-MS): Identify distance constraints between protein regions

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map solvent-accessible regions and conformational dynamics

    • Homology modeling: Utilize structural information from related proteins

    • Molecular dynamics simulations: Refine models in simulated membrane environments

  • Membrane topology determination:

    • Cysteine scanning mutagenesis: Introduce cysteines at predicted boundary regions and test accessibility

    • GFP-fusion analysis: Create terminal and internal fusions to determine orientation

    • Protease protection assays: Map accessible regions using limited proteolysis

By integrating these approaches, researchers can overcome the challenges inherent in membrane protein structural biology and generate insights into YcjF's three-dimensional organization, which would inform hypotheses about its function in Shigella sonnei pathogenesis.

What role might YcjF play in Shigella sonnei biofilm formation and how can this be experimentally validated?

Shigella sonnei specifically upregulates biofilm formation genes during infection, distinguishing it from S. flexneri . YcjF, as a membrane protein, may contribute to this process through several potential mechanisms:

Potential roles of YcjF in biofilm formation:

  • Structural component: YcjF could function as a structural element in biofilm architecture

  • Adhesion mediator: May facilitate cell-cell interactions or attachment to surfaces

  • Signaling node: Could participate in sensing environmental cues that trigger biofilm formation

  • Regulator of matrix production: Might influence production of extracellular polymeric substances

  • Stress response modulator: May contribute to survival within biofilm microenvironments

Experimental validation approaches:

  • Genetic analysis:

    • Generate precise ycjF deletion mutants in S. sonnei

    • Quantify biofilm formation using crystal violet assays comparing wild-type and ΔycjF strains

    • Perform complementation with wild-type ycjF to confirm phenotype specificity

    • Create point mutations in specific domains to identify functional regions

    • Assess epistatic relationships with known biofilm regulators (e.g., bssS, ybgD, ychH, yfcV) that are upregulated during S. sonnei infection

  • Transcriptomic analysis:

    • Compare transcriptional profiles of wild-type versus ΔycjF strains during biofilm formation

    • Perform qRT-PCR to quantify expression of known biofilm genes in the presence/absence of YcjF

    • Apply ChIP-seq to identify transcription factors that regulate ycjF expression

    • Use RNA-seq at different stages of biofilm development to track temporal expression patterns

  • Microscopic characterization:

    • Utilize confocal laser scanning microscopy with fluorescent protein fusions to track YcjF localization during biofilm formation

    • Apply scanning electron microscopy to examine structural differences in biofilms formed by wild-type versus ΔycjF strains

    • Use FRET-based reporters to detect protein-protein interactions within biofilms

    • Employ super-resolution microscopy to determine nanoscale organization

  • Biochemical approaches:

    • Perform pull-down assays to identify YcjF interaction partners during biofilm formation

    • Assess post-translational modifications that might regulate YcjF activity during biofilm development

    • Characterize changes in membrane composition in ΔycjF mutants

  • In vivo biofilm models:

    • Utilize the C. elegans infection model to evaluate in vivo biofilm formation

    • Employ flow cell systems to observe dynamic biofilm development

    • Test mixed-species biofilms to assess ecological interactions

This comprehensive approach would determine whether YcjF is a critical component of S. sonnei's enhanced biofilm formation capability, potentially explaining part of its increasing global prevalence.

What role does YcjF play in Shigella sonnei acid resistance and how does this contribute to pathogenesis?

Transcriptomic analyses have revealed that Shigella sonnei significantly upregulates acid resistance-related genes compared to Shigella flexneri during infection . As a membrane protein, YcjF may contribute to this phenotype, which could be crucial for survival during gastrointestinal transit and within various host microenvironments.

Methodological approaches to investigate YcjF's role in acid resistance:

  • Genetic and phenotypic analysis:

    • Generate precise ycjF deletion mutants in S. sonnei

    • Assess survival rates under acid challenge conditions (pH 2.5-4.0) comparing wild-type and ΔycjF strains

    • Perform acid resistance assays under various physiological conditions (stationary phase, nutrient limitation)

    • Conduct complementation studies with wild-type and mutated ycjF variants

    • Create double mutants with known acid resistance genes to establish pathway relationships

  • Transcriptomic and proteomic assessment:

    • Compare transcriptional profiles of wild-type versus ΔycjF strains under acid stress

    • Quantify expression of established acid resistance genes (e.g., gadA, gadB, gadC) in ΔycjF backgrounds

    • Perform proteome analysis to identify changes in membrane protein composition

    • Monitor cytoplasmic pH using fluorescent reporters in wild-type versus ΔycjF strains during acid challenge

  • Functional characterization:

    • Assess membrane permeability to protons in ΔycjF mutants

    • Measure intracellular pH homeostasis during acid challenge

    • Determine if YcjF affects proton-consuming decarboxylase systems

    • Investigate potential interactions with known acid resistance proteins

  • Structural studies:

    • Examine structural changes in YcjF under varying pH conditions

    • Identify pH-sensitive domains through site-directed mutagenesis

    • Assess conformational dynamics using hydrogen-deuterium exchange mass spectrometry

  • In vivo relevance:

    • Evaluate stomach transit survival in animal models

    • Assess competitive index of wild-type versus ΔycjF strains during gastric passage

    • Test colonization efficiency in various intestinal segments

    • Examine infection dynamics in the C. elegans model where differential acid resistance gene expression was observed

The results from these experiments would determine whether YcjF is a critical component of S. sonnei's enhanced acid resistance, potentially explaining part of its pathogenic success and increasing global prevalence relative to S. flexneri.

How can CRISPR-Cas9 genome editing be optimized for functional studies of YcjF in Shigella sonnei?

CRISPR-Cas9 technology offers precise genome editing capabilities that can be optimized for functional studies of YcjF in Shigella sonnei:

  • Guide RNA design optimization:

    • Design multiple sgRNAs targeting different regions of the ycjF gene

    • Prioritize targets with minimal predicted off-target effects

    • Consider PAM site availability and target site accessibility

    • Avoid regions with secondary structures that might impede Cas9 binding

    • Create a scoring table to rank sgRNAs based on:

      sgRNA IDTarget PositionPredicted EfficiencyOff-target ScoreSecondary Structure
      sgYcjF-15' region0.850.92Minimal
      sgYcjF-2Middle region0.780.97Moderate
      sgYcjF-33' region0.910.89Minimal
  • Delivery system optimization:

    • Develop electroporation protocols specifically optimized for Shigella sonnei

    • Test various plasmid systems (single vs. dual-plasmid approaches)

    • Utilize temperature-sensitive plasmids for transient Cas9 expression

    • Consider conjugation-based delivery for strains resistant to transformation

    • Assess phage-based delivery systems for difficult-to-transform strains

  • Editing strategy customization:

    • For complete knockout: Design repair templates with selectable markers

    • For scarless editing: Implement two-step selection/counterselection strategies

    • For point mutations: Design repair templates with silent mutations to prevent re-cutting

    • For protein tagging: Create in-frame fusions with minimal linker sequences

    • Employ inducible Cas9 systems for essential gene manipulation

  • Screening and validation protocols:

    • Develop PCR-based screening strategies to identify edited clones

    • Implement Sanger sequencing to confirm precise edits

    • Perform whole-genome sequencing to check for off-target modifications

    • Verify phenotypic effects using complementation studies

    • Validate protein expression changes via Western blotting

  • Advanced applications:

    • CRISPRi: Design sgRNAs targeting the ycjF promoter region for transcriptional repression

    • CRISPRa: Develop systems for controlled overexpression

    • Multiplexed editing: Target ycjF alongside other membrane proteins or virulence factors

    • Pooled screening: Create sgRNA libraries targeting different regions of ycjF to identify functional domains

By optimizing these parameters, researchers can achieve precise genetic manipulation of ycjF in Shigella sonnei, facilitating detailed functional studies of this membrane protein in the context of pathogenesis, biofilm formation, and acid resistance - phenotypes that distinguish S. sonnei from other Shigella species .

How might YcjF interact with host cell components during Shigella sonnei infection?

As a membrane protein, YcjF could potentially interact with host cell components during Shigella sonnei infection. Investigating these interactions requires specialized approaches for membrane protein-host interactions:

  • Host interaction screening methodologies:

    • Bacterial two-hybrid system: Adapt for membrane proteins to identify potential host binding partners

    • Affinity purification-mass spectrometry: Use tagged YcjF to pull down host interactors from infected cell lysates

    • Proximity labeling: Employ BioID or APEX2 fusions to label proteins in proximity to YcjF during infection

    • Yeast surface display: Screen for host peptides/proteins that bind YcjF ectodomains

  • Host pathway analysis:

    • Phosphoproteomics: Compare host signaling pathway activation between wild-type and ΔycjF infections

    • Transcriptomics: Analyze host gene expression changes in response to wild-type versus ΔycjF strains

    • Targeted pathway analysis: Focus on sphingolipid metabolism, which is specifically downregulated during S. sonnei infection

    • RNAi/CRISPR screens: Identify host factors that specifically affect ΔycjF mutant infection

  • Cellular localization studies:

    • Confocal microscopy: Track localization of fluorescently tagged YcjF during different infection stages

    • Electron microscopy: Utilize immunogold labeling to precisely localize YcjF at host-pathogen interfaces

    • Live cell imaging: Monitor dynamic interactions during invasion and intracellular growth

    • Super-resolution microscopy: Determine nanoscale organization at infection sites

  • Functional validation approaches:

    • Host protein expression: Assess if recombinant YcjF affects host cell functions when applied exogenously

    • Domain mapping: Create truncation/mutation variants to identify host-interacting regions

    • Competition assays: Test if soluble YcjF fragments can inhibit bacterial-host interactions

    • Heterologous expression: Express YcjF in non-pathogenic bacteria to confer novel host interactions

  • In vivo relevance assessment:

    • C. elegans model: Compare host response between wild-type and ΔycjF infections

    • Cell-specific responses: Analyze interaction with different host cell types (epithelial, macrophage)

    • Tissue explant studies: Examine interactions in more complex tissue environments

    • Mucosal immunity focus: Investigate interaction with host mucosal defense systems

These approaches would help determine whether YcjF contributes to the unique host responses observed during S. sonnei infection, particularly the downregulation of sphingolipid metabolism that distinguishes it from S. flexneri infection , potentially explaining aspects of S. sonnei's increasing global prevalence.

What insights can comparative proteomics provide about YcjF's role across different Shigella species and environmental conditions?

Comparative proteomics offers powerful approaches to understand YcjF's role in the context of Shigella sonnei's unique pathogenic properties and environmental adaptations:

  • Cross-species membrane proteome analysis:

    • Compare membrane proteomes of S. sonnei, S. flexneri, and related Enterobacteriaceae

    • Quantify YcjF abundance across species under identical conditions

    • Identify species-specific post-translational modifications

    • Determine if protein-protein interaction networks differ between species

    • Create reference maps of membrane protein complexes containing YcjF

    Comparative abundance data example:

    SpeciesYcjF Relative AbundanceMembrane LocalizationObserved PTMs
    S. sonnei1.00 (reference)Inner membranePhosphorylation at Ser45
    S. flexneri0.78Inner membraneNone detected
    E. coli0.65Inner membraneAcetylation at Lys120
  • Environmental condition proteomics:

    • Profile YcjF expression and modifications under conditions relevant to S. sonnei's lifecycle:

      • Acid stress (pH 2.5-6.0)

      • Bile salt exposure

      • Nutrient limitation

      • Oxidative stress

      • Biofilm formation conditions

    • Identify condition-specific YcjF interaction partners

    • Determine if environmental signals trigger post-translational modifications

  • Infection-induced proteome changes:

    • Compare host and bacterial proteomes during infection with wild-type versus ΔycjF strains

    • Correlate with transcriptomic differences observed in dual RNA-seq studies

    • Focus on biofilm and acid resistance proteins upregulated in S. sonnei

    • Track temporal changes in protein abundance during infection progression

  • Spatial proteomics:

    • Fractionate bacterial cells to determine precise subcellular localization

    • Assess if localization changes under different growth conditions or during infection

    • Compare with localization patterns of homologs in other species

    • Identify co-localized proteins that may function together with YcjF

  • Structural proteomics:

    • Apply limited proteolysis-mass spectrometry to map accessible regions

    • Use hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Implement cross-linking mass spectrometry to map interaction interfaces

    • Compare structural features across species to identify conserved functional elements

These comparative proteomic approaches would provide insights into how YcjF's expression, modification, interactions, and function might differ in S. sonnei compared to other enteric pathogens, potentially contributing to S. sonnei's increasing global prevalence as noted in epidemiological studies .

How can YcjF be incorporated into vaccine development strategies against Shigella sonnei?

As a conserved membrane protein, YcjF represents a potential target for vaccine development against Shigella sonnei. Methodological approaches to evaluate its vaccine potential include:

  • Immunogenicity assessment:

    • Natural immunity analysis: Screen sera from recovered shigellosis patients for anti-YcjF antibodies

    • Animal immunization studies: Evaluate immune responses to purified recombinant YcjF

    • Epitope mapping: Identify immunodominant regions through peptide arrays and structural analysis

    • Cross-reactivity evaluation: Assess antibody recognition of YcjF homologs across Shigella species

  • Vaccine platform exploration:

    • Subunit vaccine approaches: Formulate recombinant YcjF with appropriate adjuvants

    • Peptide epitope vaccines: Design synthetic peptides based on immunodominant epitopes

    • Live attenuated vectors: Consider incorporating enhanced ycjF expression in attenuated vaccine strains like WRSS1

    • Outer membrane vesicle (OMV) vaccines: Develop OMVs enriched for YcjF presentation

  • Protective efficacy studies:

    • Challenge models: Evaluate protection in established models:

      • Guinea pig Sereny test as used for WRSS1 vaccine evaluation

      • Mouse pulmonary infection model

      • Controlled human infection model when appropriate

    • Immune correlates analysis: Determine which immune responses correlate with protection

    • Cross-protection assessment: Test efficacy against multiple S. sonnei isolates and related species

  • Combination strategy development:

    • Multi-antigen formulations: Combine YcjF with established immunogens like O-antigen

    • Prime-boost strategies: Test heterologous prime-boost approaches

    • Adjuvant optimization: Screen adjuvant formulations for enhanced YcjF immunogenicity

    • Delivery system evaluation: Test mucosal delivery systems for targeted immune responses

  • Structural vaccinology approach:

    • Structure-based antigen design: Use structural data to optimize epitope presentation

    • Protein engineering: Create stable variants exposing protective epitopes

    • Conformational epitope mapping: Identify spatially-arranged epitopes that induce protective responses

The use of YcjF in vaccine development would build upon existing S. sonnei vaccine approaches, such as the live attenuated WRSS1 strain described in search result , which demonstrated immunogenicity in phase I trials. YcjF-based approaches could potentially address challenges in developing broadly protective vaccines against the increasingly prevalent S. sonnei.

What role might YcjF play in the epidemiological shift toward Shigella sonnei dominance in developing countries?

Epidemiological studies have documented a notable shift from Shigella flexneri to Shigella sonnei predominance in developing countries undergoing socioeconomic improvements . YcjF could potentially contribute to this phenomenon through several mechanisms that can be systematically investigated:

  • Comparative genomic analysis:

    • Global strain comparison: Analyze ycjF sequence conservation across geographically diverse S. sonnei isolates

    • Temporal analysis: Compare historical versus contemporary isolates from transitioning regions

    • Selection pressure assessment: Calculate Ka/Ks ratios to identify evolutionary forces acting on ycjF

    • Genetic context evaluation: Examine genomic regions surrounding ycjF for evidence of horizontal gene transfer or recombination

  • Environmental adaptation studies:

    • Water survival assays: Compare persistence of wild-type versus ΔycjF strains in different water sources

    • Resistance to water treatment: Evaluate survival after chlorination or other treatment methods

    • Temperature tolerance: Assess growth at variable temperatures reflecting environmental conditions

    • Comparative fitness measurements: Determine relative fitness of S. sonnei versus S. flexneri in these conditions, with and without functional YcjF

  • Host adaptation analysis:

    • Host range studies: Assess if YcjF affects adaptation to different host species or human populations

    • Microbiome interaction: Evaluate how YcjF influences competition with commensal bacteria

    • Immune evasion: Determine if YcjF contributes to evasion of specific host immune defenses

    • Nutrient acquisition: Test if YcjF enhances uptake of specific nutrients or micronutrients

  • Epidemiological correlation studies:

    • YcjF variant mapping: Correlate specific YcjF variants with geographical distribution patterns

    • Socioeconomic parameter association: Analyze relationship between YcjF sequence variants and development indicators

    • Temporal tracking: Monitor ycjF evolution during documented S. flexneri to S. sonnei transitions

    • Outbreak analysis: Compare YcjF characteristics in outbreak versus sporadic strains

  • Experimental evolution approaches:

    • Directed evolution: Subject S. sonnei to conditions mimicking developing country environments with improving water quality

    • Competition experiments: Perform head-to-head competition between S. sonnei and S. flexneri under various conditions

    • Mutant fitness assessment: Compare fitness trajectories of wild-type versus ΔycjF strains during adaptation

These approaches would help determine whether YcjF contributes to S. sonnei's apparent selective advantage in regions undergoing development, potentially through enhanced biofilm formation, acid resistance, or other adaptation mechanisms that have been shown to differ between Shigella species during infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.