Recombinant Shigella sonnei UPF0442 protein yjjB (yjjB)

What is UPF0442 protein yjjB and where is it found in Shigella sonnei?

UPF0442 protein yjjB is a protein encoded by the yjjB gene in Shigella sonnei, specifically identified in the Ss046 strain. It is a full-length protein consisting of 157 amino acids and is classified as part of the UPF (Uncharacterized Protein Family) 0442 . This protein is chromosomally encoded, with the gene designated as SSON_4509 in the ordered locus names for Shigella sonnei . Within the context of S. sonnei's genome (which totals approximately 4,546,505 bp), yjjB represents one of many proteins that may contribute to the organism's pathogenic capabilities .

What is the amino acid sequence of Shigella sonnei UPF0442 protein yjjB?

The complete amino acid sequence of the Shigella sonnei UPF0442 protein yjjB is:
MGVIEFLFALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIEWSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEPLMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV

This 157-amino acid sequence can be analyzed for structural motifs, transmembrane domains, and functional regions that might provide insights into the protein's biological role within S. sonnei.

How should researchers store and handle recombinant Shigella sonnei UPF0442 protein yjjB?

For optimal stability and activity, recombinant Shigella sonnei UPF0442 protein yjjB should be stored in a Tris-based buffer supplemented with 50% glycerol . The recommended storage temperature is -20°C for regular use or -80°C for extended storage periods . Working aliquots can be maintained at 4°C for up to one week . Importantly, repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . When designing experiments, researchers should account for the buffer composition and optimize assay conditions accordingly to maintain protein stability throughout experimental procedures.

What experimental systems are suitable for studying UPF0442 protein yjjB function?

What is the predicted structure and potential function of UPF0442 protein yjjB based on its amino acid sequence?

Based on the amino acid sequence, UPF0442 protein yjjB appears to be a membrane-associated protein with multiple hydrophobic regions, suggesting it may function within the bacterial membrane system. The sequence "MGVIEFLFALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE" contains several hydrophobic residues that could form transmembrane domains . While the specific function remains uncharacterized (hence the UPF designation), structural analysis suggests it might be involved in membrane transport, signaling, or maintaining membrane integrity.

For experimental determination of structure, researchers should consider:

• X-ray crystallography of the purified protein

• NMR spectroscopy for dynamic structural analysis

• Cryo-EM for visualization of membrane-embedded conformations

• Molecular dynamics simulations based on homology models

Functional analysis could be approached through site-directed mutagenesis of conserved residues, particularly those in predicted functional domains, followed by phenotypic characterization of mutant strains.

How might UPF0442 protein yjjB contribute to Shigella sonnei virulence and pathogenicity?

While the specific role of UPF0442 protein yjjB in S. sonnei virulence has not been directly established in the provided research, its potential contribution should be considered within the context of S. sonnei's known virulence mechanisms. S. sonnei possesses multiple virulence factors, including type III secretion system (T3SS) and type VI secretion system (T6SS), which enable host cell invasion and competitive advantage over other bacteria, respectively .

Methodological approaches to investigate yjjB's role in virulence could include:

• Gene knockout studies comparing wild-type and ΔyjjB mutant strains for:

  • Epithelial cell invasion efficiency

  • Intracellular replication rates

  • Resistance to host defense mechanisms

  • Competitive fitness against other enteric bacteria

• Protein localization studies to determine if yjjB associates with known virulence structures:

  • Immunogold electron microscopy

  • Fluorescence microscopy with tagged protein variants

  • Subcellular fractionation followed by Western blotting

• Interactome analysis to identify protein-protein interactions with established virulence factors:

  • Co-immunoprecipitation assays

  • Bacterial two-hybrid systems

  • Proximity-dependent biotin labeling (BioID)

Given that S. sonnei has been shown to outcompete other Enterobacteriaceae through T6SS-mediated mechanisms , investigating whether yjjB plays a role in this competitive advantage could be particularly insightful.

How can researchers design effective gene knockout experiments to study UPF0442 protein yjjB function in Shigella sonnei?

An effective gene knockout experimental design for studying UPF0442 protein yjjB function would involve:

• Generation of precise deletion mutants:

  • Use homologous recombination or CRISPR-Cas9 technology to target the SSON_4509 locus

  • Create both complete gene deletion and domain-specific mutations

  • Include genomic complementation constructs for validation

• Phenotypic characterization protocol:

  • Growth curves in standard and stress conditions (pH, temperature, antimicrobial peptides)

  • Microscopic analysis of cell morphology and membrane integrity

  • Competitive growth assays with wild-type S. sonnei and other enteric bacteria

  • Host cell invasion and intracellular survival assays

• Comparative transcriptomics and proteomics:

  • RNA-seq to identify genes differentially expressed in the knockout strain

  • Proteomics to detect changes in protein expression patterns

  • Metabolomics to identify altered metabolic pathways

• In vivo relevance assessment:

  • Animal infection models comparing wild-type and knockout strains

  • Analysis of colonization, persistence, and competitive fitness in vivo

  • Host immune response characterization

When interpreting results, researchers should consider potential compensatory mechanisms that might mask phenotypes, as well as the possibility of polar effects on neighboring genes.

What approaches can be used to investigate potential interactions between UPF0442 protein yjjB and host cellular components?

To investigate potential interactions between UPF0442 protein yjjB and host cellular components, researchers can employ several complementary approaches:

• Direct binding assays:

  • ELISA-based binding studies using purified recombinant yjjB protein and candidate host proteins

  • Surface plasmon resonance to determine binding kinetics and affinity

  • Far-Western blotting to screen host cell lysates for binding partners

• Cell biology approaches:

  • Transfection of tagged yjjB into host cells followed by immunoprecipitation

  • Confocal microscopy to visualize localization of yjjB in infected cells

  • FRET/BRET analysis to detect direct interactions with candidate host proteins

• Functional screens:

  • RNAi or CRISPR screens in host cells to identify factors affecting yjjB function

  • Yeast two-hybrid screening against human cDNA libraries

  • BioID or proximity labeling in infected cells

• Structural biology:

  • Co-crystallization of yjjB with identified host binding partners

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

These approaches should be integrated with knowledge of S. sonnei pathogenesis mechanisms, including its ability to invade host epithelial cells, escape from vacuoles, and manipulate inflammatory responses .

How conserved is UPF0442 protein yjjB across different Shigella species and related enterobacteria?

The conservation of UPF0442 protein yjjB across Shigella species and related enterobacteria provides insights into its evolutionary importance and potential functional significance. While specific conservation data for yjjB is not explicitly provided in the search results, a methodological approach to answering this question would involve:

• Sequence homology analysis:

  • BLAST searches against genomes of S. flexneri, S. dysenteriae, S. boydii, and E. coli

  • Multiple sequence alignment to identify conserved domains and residues

  • Calculation of sequence identity and similarity percentages

• Synteny analysis:

  • Examination of gene neighborhood conservation across species

  • Identification of co-evolved gene clusters

• Phylogenetic analysis:

  • Construction of phylogenetic trees based on yjjB sequences

  • Comparison with species trees to identify potential horizontal gene transfer events

How does UPF0442 protein yjjB expression change under different environmental conditions relevant to infection?

Understanding how UPF0442 protein yjjB expression is regulated under different environmental conditions can provide insights into its potential role during infection. A methodological approach to investigating this question would include:

• Transcriptional analysis:

  • qRT-PCR of yjjB expression under varying conditions (pH, temperature, oxygen levels, bile salts)

  • Reporter gene constructs (e.g., yjjB promoter-GFP fusions) to monitor expression in real-time

  • RNA-seq to place yjjB regulation in the context of global transcriptional responses

• Protein level analysis:

  • Western blotting with specific antibodies against yjjB under different conditions

  • Proteomic analysis of S. sonnei grown in infection-relevant conditions

  • Half-life determination of yjjB protein in different environments

• Infection model analysis:

  • In vitro cell culture infection models to assess yjjB expression during different stages of infection

  • Animal model studies examining tissue-specific expression patterns

Of particular interest would be examining yjjB expression in response to bile salts, which are known to promote the secretion of S. sonnei effector proteins and enhance attachment to polarized cells . Additionally, investigating expression changes in response to host antimicrobial peptides could be relevant given S. sonnei's ability to resist these defense mechanisms .

What are the optimal conditions for expressing and purifying recombinant Shigella sonnei UPF0442 protein yjjB?

For optimal expression and purification of recombinant Shigella sonnei UPF0442 protein yjjB, researchers should consider the following methodological approach:

• Expression system selection:

  • E. coli-based expression systems (BL21(DE3), Rosetta, or SHuffle strains for potential disulfide bonds)

  • Expression vectors incorporating the full 1-157 amino acid sequence

  • Selection of appropriate tags based on downstream applications

• Expression optimization:

  • Temperature screening (typically 16-37°C, with lower temperatures often favoring proper folding)

  • Induction conditions (IPTG concentration and induction time)

  • Media composition (complex vs. minimal media, supplementation with trace elements)

• Purification strategy:

  • Initial capture using affinity chromatography based on the incorporated tag

  • Intermediate purification using ion exchange chromatography

  • Polishing step using size exclusion chromatography

  • Buffer optimization containing Tris-based components with stabilizers

• Quality control:

  • SDS-PAGE and Western blotting to confirm purity and identity

  • Mass spectrometry for accurate molecular weight determination

  • Circular dichroism to assess secondary structure integrity

  • Dynamic light scattering to evaluate homogeneity

The final storage buffer should contain Tris with 50% glycerol as indicated in the product specifications , and aliquots should be stored at -20°C or -80°C to maintain stability for extended periods.

What analytical techniques are most appropriate for studying the structure-function relationship of UPF0442 protein yjjB?

To elucidate the structure-function relationship of UPF0442 protein yjjB, researchers should employ a multidisciplinary approach combining various analytical techniques:

By integrating these approaches, researchers can connect structural features of yjjB to its biological function, particularly in the context of S. sonnei's pathogenic mechanisms which include complex systems like T3SS and T6SS that facilitate host invasion and bacterial competition .

How can researchers develop specific antibodies against UPF0442 protein yjjB for immunological studies?

Developing specific antibodies against UPF0442 protein yjjB requires a systematic approach to ensure high specificity and affinity. A comprehensive methodological strategy would include:

• Antigen preparation:

  • Use of highly purified recombinant full-length protein (expression region 1-157)

  • Alternatively, design of synthetic peptides based on predicted antigenic epitopes

  • Consideration of protein tag influence on immunogenicity and subsequent antibody specificity

• Immunization strategies:

  • Selection of appropriate animal models (rabbits for polyclonal, mice for monoclonal antibodies)

  • Prime-boost immunization protocols with optimal adjuvant selection

  • Monitoring of immune response through test bleeds and ELISA

• Antibody production and purification:

  • For polyclonal antibodies: serum collection, IgG purification, and affinity purification against immobilized yjjB

  • For monoclonal antibodies: hybridoma generation, screening, cloning, and production

  • Validation of antibody specificity against recombinant protein and native protein in S. sonnei lysates

• Characterization and validation:

  • Western blotting to confirm specificity and determine detection limits

  • Immunoprecipitation efficiency testing

  • Immunofluorescence microscopy to confirm specific labeling

  • Cross-reactivity testing against homologous proteins from related species

The resulting antibodies would be valuable tools for studying yjjB expression, localization, and interactions within S. sonnei, potentially revealing its role in virulence mechanisms similar to other proteins involved in S. sonnei pathogenesis .

What are the most promising research directions for understanding UPF0442 protein yjjB's role in Shigella sonnei biology?

Based on current knowledge about Shigella sonnei pathogenesis and the limited information about UPF0442 protein yjjB, several promising research directions emerge:

• Functional characterization in the context of S. sonnei virulence:

  • Investigation of potential roles in membrane integrity or transport

  • Analysis of contribution to stress responses and environmental adaptation

  • Examination of interactions with known virulence systems (T3SS, T6SS)

• Comparative genomics and evolutionary biology:

  • Examination of yjjB conservation and evolution across Shigella species

  • Analysis of selection pressures on the yjjB gene

  • Investigation of potential horizontal gene transfer events

• Host-pathogen interaction studies:

  • Identification of potential host cell targets or interacting partners

  • Analysis of yjjB's role in immune evasion or modulation

  • Examination of contribution to S. sonnei's competitive advantage over other enteric bacteria

• Structural biology and drug discovery:

  • Determination of high-resolution structure

  • Identification of potential inhibitor binding sites

  • Development of small molecule modulators as research tools

These research directions should be pursued in the context of S. sonnei's emerging global significance as a pathogen, particularly its increasing antimicrobial resistance and changing epidemiological patterns .

How might UPF0442 protein yjjB interact with known virulence mechanisms of Shigella sonnei?

Investigation of potential interactions between UPF0442 protein yjjB and established S. sonnei virulence mechanisms represents an important research direction. A methodological approach would include:

• Genetic interaction studies:

  • Construction of double mutants (yjjB plus known virulence genes)

  • Synthetic genetic array analysis to identify genetic interactions

  • Transcriptional profiling of yjjB mutants to identify affected virulence pathways

• Protein-protein interaction analysis:

  • Co-immunoprecipitation with components of T3SS and T6SS machinery

  • Bacterial two-hybrid screening against known virulence factors

  • Proximity labeling in living bacteria to identify spatial associations

• Functional assays in the context of virulence:

  • Assessment of T3SS and T6SS efficiency in yjjB mutants

  • Analysis of effector protein secretion and translocation

  • Evaluation of interbacterial competition mediated by T6SS

• Structural studies of potential complexes:

  • Co-crystallization attempts with identified interacting partners

  • Cryo-EM of larger macromolecular assemblies

  • Computational modeling of potential interaction interfaces

S. sonnei employs multiple virulence mechanisms, including adhesion, invasion, intracellular replication, and immune evasion . Understanding how yjjB potentially contributes to these processes would enhance our comprehension of S. sonnei pathogenesis and could identify new targets for therapeutic intervention in the context of increasing antimicrobial resistance .