Recombinant Shigella sonnei UPF0761 membrane protein yihY (yihY)

What is the UPF0761 membrane protein YihY and what is its role in Shigella sonnei?

The UPF0761 membrane protein YihY is a bacterial membrane protein found in Shigella species, including Shigella sonnei. While its precise function remains under investigation, structural analysis indicates it belongs to the UPF0761 protein family, which consists of transmembrane proteins with potential roles in membrane transport, signaling, or structural integrity.

The amino acid sequence analysis of related proteins (such as in Shigella boydii) reveals a 290-amino acid protein with hydrophobic regions consistent with transmembrane domains. The full amino acid sequence includes regions like "MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP," which contains multiple hydrophobic segments characteristic of membrane proteins .

What expression systems are recommended for recombinant production of Shigella sonnei YihY protein?

For recombinant production of Shigella sonnei YihY protein, Escherichia coli expression systems are most commonly utilized due to their compatibility with bacterial membrane proteins and efficient expression of prokaryotic genes. Based on successful expression patterns with similar proteins, the BL21(DE3) strain is particularly effective for membrane protein expression.

The methodological approach involves:

• Gene synthesis or PCR amplification of the yihY gene from Shigella sonnei genomic DNA

• Cloning into an expression vector with an appropriate promoter (T7 promoter systems work effectively)

• Addition of a purification tag (typically His-tag at the N-terminus) to facilitate purification

• Transformation into competent E. coli BL21(DE3) cells

• Culture in LB medium supplemented with appropriate antibiotics

• Induction of protein expression using IPTG (typically 0.5-1 mM) when cultures reach OD600 of 0.6-0.8

• Expression at lower temperatures (16-25°C) to enhance proper folding of membrane proteins

Similar approaches have been successful for other recombinant Shigella proteins, with expression levels confirmed via SDS-PAGE and Western blot techniques .

What purification strategies yield the highest purity for recombinant YihY protein?

Purification of recombinant YihY membrane protein requires specialized approaches due to its hydrophobic nature. The following methodological workflow yields high purity (>90%) recombinant protein:

• Cell lysis: Sonication or high-pressure homogenization in buffer containing suitable detergents (typically n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane proteins

• Centrifugation: Differential centrifugation to separate solubilized membrane fractions

• Immobilized metal affinity chromatography (IMAC): Using Ni-NTA resin for His-tagged proteins

• Size exclusion chromatography: For further purification and buffer exchange

• Quality assessment: SDS-PAGE analysis to confirm purity >90%

Post-purification handling is critical - the protein should be stored in a stabilizing buffer containing:

• Tris/PBS-based buffer

• 6% Trehalose

• pH 8.0

• Optional addition of glycerol (final concentration 5-50%) for long-term storage

Lyophilization may be performed for extended storage, with reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL prior to experimental use .

How can translation initiation site accessibility be optimized to improve recombinant YihY expression levels?

Optimizing translation initiation site accessibility represents a critical strategy for improving recombinant YihY expression, particularly given that approximately 50% of recombinant proteins fail to express adequately in host cells. The optimization process involves:

• Analysis of mRNA secondary structure at the translation initiation region using Boltzmann's ensemble modeling

• Implementation of synonymous codon substitutions within the first nine codons of the mRNA sequence using tools like TIsigner

• Calculation of the Codon Adaptation Index (CAI) to ensure compatibility with E. coli codon usage preferences (optimal CAI value >0.8)

Research has demonstrated that higher translation initiation site accessibility directly correlates with increased protein production. A comprehensive study analyzing 11,430 recombinant proteins from 189 species showed that accessibility modeling significantly outperforms alternative features in predicting expression success .

Systematic optimization approaches should focus on:

What are the key considerations for structural characterization of purified YihY protein?

Structural characterization of purified YihY protein presents unique challenges due to its hydrophobic transmembrane domains. A comprehensive characterization approach should include:

• Secondary structure analysis:

  • Circular dichroism (CD) spectroscopy to determine α-helical and β-sheet content

  • FTIR spectroscopy to confirm membrane protein secondary structure elements

• Tertiary structure determination:

  • X-ray crystallography (requires specialized membrane protein crystallization techniques)

  • Cryo-electron microscopy for high-resolution structural analysis

  • NMR spectroscopy for dynamic structural information

• Membrane topology mapping:

  • Cysteine-scanning mutagenesis with subsequent accessibility analysis

  • Protease protection assays to determine exposed regions

  • Fluorescence resonance energy transfer (FRET) analysis for distance measurements

• Functional characterization:

  • Reconstitution into liposomes or nanodiscs to study potential transport activity

  • Binding assays to identify interaction partners

  • Site-directed mutagenesis of conserved residues to determine functional importance

Based on predictive modeling of related UPF0761 proteins, YihY likely contains multiple transmembrane helices with potential substrate binding sites within the membrane-spanning regions. Careful consideration of detergent selection during purification is essential for maintaining native-like structure during characterization experiments .

How can immunogenicity studies be designed to evaluate YihY as a potential vaccine candidate against Shigella sonnei?

Designing immunogenicity studies for YihY as a potential vaccine candidate requires systematic evaluation of both humoral and cellular immune responses. The methodological framework should include:

• Animal model selection:

  • Mouse models (BALB/c or C57BL/6) for initial immunogenicity assessment

  • Guinea pig models for more translatable intestinal responses

  • Non-human primates for advanced pre-clinical evaluation

• Immunization protocol design:

  • Primary immunization with purified recombinant YihY (typically 10-50 μg)

  • Adjuvant selection (aluminum hydroxide, CFA/IFA, or more advanced adjuvants)

  • Booster immunizations at 2-4 week intervals

  • Multiple administration routes (subcutaneous, intranasal, oral) to determine optimal delivery

• Immune response assessment:

  • ELISA for quantification of YihY-specific antibodies (IgG, IgA)

  • ELISpot assays for T-cell responses (IFN-γ, IL-4, IL-17)

  • Flow cytometry for detailed immune cell phenotyping

  • Functional antibody assays (bactericidal, opsonization)

• Challenge studies:

  • Controlled Shigella sonnei challenge in appropriate animal models

  • Monitoring for clinical symptoms, bacterial shedding, and histopathological changes

It's worth noting that a bioinformatic approach similar to that used for other Shigella proteins can be applied to YihY. Such analyses have successfully identified immunogenic regions in other bacterial membrane proteins. In silico prediction tools can identify B-cell and T-cell epitopes within the YihY sequence to refine vaccine design. Similar approaches with other Shigella proteins have demonstrated that by the third immunization, IgG and IgM titers reach desirable protective levels .

What are the optimal conditions for Western blot detection of recombinant YihY protein?

Western blot detection of recombinant YihY protein requires optimized conditions due to the hydrophobic nature of membrane proteins. The following methodological approach ensures sensitive and specific detection:

• Sample preparation:

  • Addition of reducing agent (DTT or β-mercaptoethanol) to disrupt protein aggregates

  • Heat denaturation at lower temperatures (37°C for 30 minutes instead of 95°C for 5 minutes) to prevent aggregation

  • Addition of 6M urea to improve solubility if necessary

• Gel electrophoresis:

  • Use of gradient gels (4-20%) for better resolution

  • Lower running voltage (80-100V) to prevent overheating and band distortion

  • Extended running time to ensure complete separation

• Transfer conditions:

  • Semi-dry transfer systems with specialized buffers containing 20% methanol and 0.1% SDS

  • Lower voltage transfer (15V for 30-45 minutes) to prevent heat-induced protein aggregation

  • Use of PVDF membranes (rather than nitrocellulose) for better protein retention

• Detection optimization:

  • Primary antibody: Anti-His tag monoclonal antibody (1:1000-1:5000 dilution)

  • Secondary antibody: HRP-conjugated anti-mouse IgG (1:5000-1:10000 dilution)

  • Enhanced chemiluminescence detection with extended exposure times

For YihY protein specifically, visualization is expected at approximately 33-34 kDa (considering the protein length of 290 amino acids plus His-tag). Similar approaches have been successful for detection of other Shigella outer membrane proteins of comparable size ranges (29.0-100.3 kDa) .

How can researchers evaluate the membrane localization and topology of YihY in bacterial cells?

Evaluating membrane localization and topology of YihY in bacterial cells requires multiple complementary techniques:

• Subcellular fractionation:

  • Differential centrifugation to separate cytoplasmic, periplasmic, and membrane fractions

  • Sucrose gradient ultracentrifugation for further membrane refinement (inner vs. outer membrane)

  • Western blot analysis of fractions using anti-YihY antibodies

• Fluorescence microscopy:

  • Construction of fluorescent protein fusions (GFP-YihY)

  • Live-cell imaging to visualize membrane localization patterns

  • Co-localization with established membrane markers

• Topology mapping techniques:

  • PhoA/LacZ fusion analysis at different positions to determine orientation

  • SCAM (substituted cysteine accessibility method) to identify exposed regions

  • Limited proteolysis of spheroplasts vs. intact cells to determine exposed domains

• Bioinformatic prediction validation:

  • Experimental validation of transmembrane domains predicted by algorithms (TMHMM, HMMTOP)

  • Assessment of signal sequence functionality

A comprehensive topology analysis would generate a detailed membrane orientation map, identifying cytoplasmic, periplasmic, and transmembrane domains. This information is crucial for functional studies and for determining potentially exposed epitopes that might serve as diagnostic or vaccine targets .

What methods are available for assessing the functional activity of purified YihY protein?

Assessing the functional activity of purified YihY protein poses a significant challenge due to its uncharacterized function. A systematic approach to functional characterization includes:

• Reconstitution into membrane mimetics:

  • Proteoliposome formation using E. coli lipid extracts

  • Incorporation into nanodiscs with MSP (membrane scaffold protein)

  • Reconstitution into giant unilamellar vesicles (GUVs) for single-molecule studies

• Transport activity screening:

  • Liposome-based flux assays with various substrates (ions, small molecules)

  • Membrane potential measurements using voltage-sensitive dyes

  • Patch-clamp electrophysiology for detailed conductance measurements

• Protein-protein interaction studies:

  • Pull-down assays using His-tagged YihY as bait

  • Bacterial two-hybrid screening to identify interaction partners

  • Cross-linking mass spectrometry to map interaction surfaces

• Comparative genomics approach:

  • Functional prediction based on conserved domains

  • Expression pattern analysis during different growth phases

  • Phenotypic analysis of yihY knockout mutants

For proteins of unknown function like YihY, a combinatorial approach that leverages both targeted hypothesis testing and unbiased screening methods is recommended. Similar approaches have been successful in characterizing other membrane proteins from Shigella, revealing functions in pathogenesis, antibiotic resistance, or nutrient acquisition .

How can YihY protein be evaluated as a potential diagnostic biomarker for Shigella sonnei infections?

Evaluation of YihY protein as a potential diagnostic biomarker for Shigella sonnei infections requires a systematic assessment of its specificity, sensitivity, and practical applicability:

• Specificity determination:

  • Sequence homology analysis against other Enterobacteriaceae

  • Cross-reactivity testing using sera from patients infected with related pathogens

  • Western blot analysis to confirm unique epitopes

• Antibody development:

  • Production of polyclonal antibodies against recombinant YihY

  • Development of monoclonal antibodies targeting specific epitopes

  • Characterization of antibody specificity and sensitivity

• Immunoassay optimization:

  • Development of ELISA protocols with optimized blocking and washing conditions

  • Determination of detection limits and linear range

  • Comparison with established diagnostic methods (culture, PCR)

• Clinical validation:

  • Testing with clinical samples from confirmed Shigella sonnei cases

  • Determination of sensitivity and specificity metrics

  • Evaluation of positive and negative predictive values

Recent research on Shigella sonnei outer membrane proteins has demonstrated the diagnostic potential of similar proteins. An optimized ELISA using Shigella sonnei outer membrane proteins demonstrated sensitivity and specificity exceeding 86.0%, suggesting that membrane proteins like YihY could serve as effective biomarkers. The approach parallels successful work with other outer membrane proteins (33.3 kDa, 43.8 kDa, and 100.3 kDa) that showed specific recognition when probed with S. sonnei sera .

What strategies can improve the stability of recombinant YihY protein for long-term storage and research applications?

Improving stability of recombinant YihY membrane protein for long-term storage requires specialized approaches that address the unique challenges of membrane protein preservation:

• Buffer optimization:

  • Tris/PBS-based buffer at pH 8.0 serves as an effective base

  • Addition of 6% trehalose acts as a lyoprotectant and stability enhancer

  • Optional inclusion of glycerol (5-50% final concentration) prevents aggregation during freeze-thaw cycles

• Storage condition optimization:

  • Aliquoting into single-use volumes to avoid repeated freeze-thaw cycles

  • Storage at -80°C for long-term preservation

  • Working aliquots can be maintained at 4°C for up to one week

• Stabilization strategies:

  • Addition of mild detergents at concentrations slightly above CMC

  • Incorporation of lipids to maintain native-like environment

  • Use of stabilizing additives (sucrose, glycine)

• Alternative preservation methods:

  • Lyophilization with appropriate cryoprotectants

  • Spray-drying with stabilizing excipients

  • Vitrification techniques to prevent crystalline structure formation

For reconstitution of lyophilized YihY protein, it is recommended to:

• Briefly centrifuge the vial before opening

• Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 50% for storage stability

These approaches have been shown to maintain protein integrity and functionality for extended periods, with minimal loss of activity when proper storage protocols are followed .

How can computational approaches be used to predict immunogenic epitopes within YihY for vaccine development?

Computational approaches for predicting immunogenic epitopes within YihY provide powerful tools for rational vaccine design. A comprehensive computational immunology workflow includes:

• B-cell epitope prediction:

  • Sequence-based prediction using BepiPred, ABCpred, and LBtope algorithms

  • Structure-based prediction using DiscoTope and EPCES when structural data is available

  • Accessibility analysis to identify surface-exposed regions

  • Conservation analysis across Shigella strains to identify stable epitopes

• T-cell epitope prediction:

  • MHC-I binding prediction using NetMHCpan and IEDB analysis tools

  • MHC-II epitope prediction with NetMHCIIpan

  • Immunogenicity prediction to prioritize strong epitopes

  • Population coverage analysis to ensure broad protection

• Epitope refinement:

  • Molecular dynamics simulations to assess epitope flexibility

  • Docking studies with antibodies or MHC molecules

  • Cross-reactivity analysis to avoid self-antigens or beneficial microbiota

• Epitope validation:

  • Synthetic peptide production of predicted epitopes

  • In vitro binding assays with recombinant MHC molecules

  • T-cell activation assays using PBMCs from convalescent patients

Using similar approaches, researchers have successfully identified immunogenic regions in other Shigella proteins. Computational vaccine design using the C-ImmSim server has demonstrated that properly designed immunogens can induce significant IgG and IgM titers by the third injection, providing protective immunity .

What are common expression challenges with recombinant YihY protein and how can they be addressed?

Recombinant expression of membrane proteins like YihY presents several challenges that require specific troubleshooting approaches:

• Low expression levels:

  • Challenge: Membrane proteins often express poorly in standard systems

  • Solution: Optimize translation initiation site accessibility through synonymous codon substitutions in the first 9 codons

  • Implementation: Use TIsigner or similar tools to model mRNA secondary structure and improve accessibility

  • Expected outcome: 2-5 fold increase in expression levels

• Protein misfolding and inclusion body formation:

  • Challenge: Membrane proteins tend to aggregate without proper membrane integration

  • Solution: Lower induction temperature (16-20°C) and reduce IPTG concentration (0.1-0.5 mM)

  • Implementation: Extended expression time (16-24 hours) at lower temperatures

  • Expected outcome: Increased proportion of properly folded protein in membrane fractions

• Cytotoxicity:

  • Challenge: Overexpression of membrane proteins can disrupt host cell membranes

  • Solution: Use of specialized expression strains (C41/C43) developed for toxic membrane proteins

  • Implementation: Test expression in multiple host strains to identify optimal system

  • Expected outcome: Reduced cell death and higher yields

• Poor solubilization:

  • Challenge: Inefficient extraction from membranes during purification

  • Solution: Screen multiple detergents (DDM, LDAO, CHAPS) at various concentrations

  • Implementation: Small-scale detergent screening prior to large-scale purification

  • Expected outcome: Improved extraction efficiency and protein stability

Research has shown that approximately 50% of recombinant proteins fail to be adequately expressed in host cells, highlighting the importance of these optimization strategies. Accessibility of translation initiation sites has been identified as a critical factor, with appropriate modifications enabling successful expression of proteins from diverse species .

How can researchers optimize protein yield while maintaining proper folding of YihY protein?

Optimizing protein yield while maintaining proper folding of YihY requires balancing high expression with conditions that support correct membrane protein structure:

• Expression vector optimization:

  • Selection of moderate-strength inducible promoters (trc, tac) rather than very strong promoters (T7)

  • Addition of fusion partners that enhance folding (MBP, Mistic, SUMO)

  • Incorporation of periplasmic targeting sequences if appropriate

• Culture condition optimization:

  • Media supplementation with glycerol (0.5-1%) to provide additional energy source

  • Addition of specific phospholipids to support membrane protein folding

  • Use of molecular chaperone co-expression systems (GroEL/GroES, DnaK/DnaJ)

• Induction strategy:

  • Auto-induction media for gradual protein production

  • Pulse induction with periodic additions of small amounts of inducer

  • Optimized cell density for induction (OD600 = 0.6-0.8)

• Purification optimization:

  • Affinity purification under mild conditions to preserve protein structure

  • On-column refolding protocols if necessary

  • Immediate addition of stabilizing lipids post-purification

What are the key considerations for designing experiments to investigate YihY's role in Shigella pathogenesis?

Designing experiments to investigate YihY's role in Shigella pathogenesis requires a multi-faceted approach that combines genetic, biochemical, and infection models:

• Genetic manipulation strategies:

  • Construction of yihY knockout mutants using CRISPR-Cas9 or allelic exchange

  • Development of conditional expression systems (tetracycline-inducible)

  • Complementation studies to confirm phenotype specificity

  • Site-directed mutagenesis of conserved residues to identify functional domains

• Phenotypic characterization:

  • Growth curve analysis under various stress conditions

  • Antibiotic susceptibility testing to identify potential transport functions

  • Membrane integrity assessment using dye uptake assays

  • Biofilm formation assays to evaluate community behavior changes

• In vitro infection models:

  • Adhesion and invasion assays using relevant cell lines (Caco-2, HT-29)

  • Intracellular survival quantification in macrophage models

  • Transepithelial resistance measurements to assess barrier disruption

  • Cytokine response profiling from infected epithelial cells

• In vivo infection studies:

  • Animal models of shigellosis (guinea pig or nonhuman primate)

  • Competitive index assays comparing wild-type vs. yihY mutants

  • Histopathological analysis of infected tissues

  • Immune response characterization (innate and adaptive)

For membrane proteins of unknown function like YihY, comparative studies with other characterized outer membrane proteins can provide valuable context. Research on other Shigella membrane proteins has revealed their importance in pathogenesis, including their potential as diagnostic biomarkers and vaccine candidates. Similar approaches could uncover whether YihY plays a role in adhesion, invasion, immune evasion, or nutrient acquisition during infection .