Recombinant Shigella sonnei Zinc transport protein ZntB (zntB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zntB; SSON_1789; Zinc transport protein ZntB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Shigella sonnei (strain Ss046)
Target Names
zntB
Target Protein Sequence
MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL
Uniprot No.

Target Background

Function
Mediates the efflux of zinc ions.
Database Links
Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Zinc transport protein ZntB in Shigella sonnei, and what is its primary function?

The Zinc transport protein ZntB in Shigella sonnei (UniProt: Q3Z192) is a membrane protein that plays a critical role in zinc homeostasis. ZntB functions as a zinc efflux system, specifically as a Zn²⁺/H⁺ symporter that transports zinc ions across bacterial membranes . This protein is essential for maintaining appropriate intracellular zinc concentrations, which is crucial for bacterial survival under varying environmental conditions. The protein is encoded by the zntB gene (locus name: SSON_1789) and consists of 327 amino acids in its full-length form . Like other bacterial zinc transporters, ZntB helps protect cells from zinc toxicity while ensuring sufficient zinc availability for cellular processes.

What are the optimal conditions for expressing recombinant Shigella sonnei ZntB protein?

For optimal expression of recombinant S. sonnei ZntB, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli-based expression systems (BL21(DE3) or similar strains) are typically suitable for bacterial membrane proteins like ZntB.

  • Vector Design:

    • Use vectors with inducible promoters (T7 or similar)

    • Include appropriate fusion tags for purification (His-tag commonly used)

    • Consider codon optimization for the expression host

  • Culture Conditions:

    • Initial growth at 37°C to OD₆₀₀ of 0.6-0.8

    • Induction with IPTG (0.1-1.0 mM)

    • Post-induction temperature reduction to 16-25°C to enhance proper folding

    • Extended expression time (12-24 hours) at reduced temperature

  • Media Optimization:

    • Rich media (LB or TB) for high biomass

    • Consider supplementation with 0.1-0.5 mM ZnSO₄ to stabilize the protein

    • Avoid excessive zinc that might be toxic to the expression host

While specific optimized conditions for S. sonnei ZntB are not directly reported in the provided sources, these recommendations are based on established protocols for similar membrane transporters and can serve as a starting point for optimization .

What purification strategies yield the highest purity and functional activity for recombinant ZntB?

A comprehensive purification strategy for recombinant ZntB should include these methodological steps:

  • Membrane Fraction Isolation:

    • Cell lysis via sonication or high-pressure homogenization in buffer containing protease inhibitors

    • Differential centrifugation to separate membrane fractions (typically 40,000-100,000 × g)

    • Membrane solubilization using appropriate detergents

  • Detergent Selection:

    • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-decyl-β-D-maltoside (DM) typically preserve functional activity

    • Concentration should be above critical micelle concentration (CMC)

  • Chromatography Steps:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) for His-tagged protein

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography to remove aggregates

  • Buffer Optimization:

    • Maintain 0.1-0.5 mM zinc in buffers to stabilize the protein

    • Include glycerol (10-20%) to enhance stability

    • pH range 7.0-8.0 typically optimal for zinc transporters

The purified protein can be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage . For working stocks, aliquot and store at 4°C for up to one week, as repeated freeze-thaw cycles may reduce activity .

How can researchers verify the structural integrity and functional activity of purified recombinant ZntB?

Verification of structural integrity and functional activity of purified recombinant ZntB should employ multiple complementary approaches:

When conducting zinc binding assays like ITC, use buffers free of competing metal ions and chelators. For transport assays, the pH gradient across the membrane should be carefully controlled to assess the Zn²⁺/H⁺ symport activity .

What is the recommended experimental design for studying ZntB-mediated zinc transport in vitro?

An optimal experimental design for studying ZntB-mediated zinc transport in vitro should follow these methodological steps:

  • Reconstitution System Selection:

    • Proteoliposomes: Provide controlled environment for transport studies

    • Nanodiscs: Allow for single-molecule studies and better accessibility

    • Black lipid membranes: Enable electrophysiological measurements

  • Experimental Variables to Control:

    • Zinc concentration gradient (typically 0.1-100 μM across membrane)

    • pH gradient (to assess H⁺ coupling)

    • Membrane potential (±60-120 mV)

    • Temperature (25-37°C)

    • Buffer composition (avoiding competing ions)

  • Measurement Methods:

    MethodMeasurementAdvantagesLimitations
    Radioisotope assays (⁶⁵Zn)Direct zinc fluxHigh sensitivity, quantitativeRequires radioactive handling
    Fluorescent zinc indicatorsReal-time zinc fluxReal-time kinetics, non-radioactivePotential interference from indicators
    ICP-MSTotal zinc contentHighly sensitive and specificEndpoint measurements only
    ElectrophysiologyCurrent generated by transportReal-time activity, mechanistic insightsTechnically challenging
  • Control Experiments:

    • Empty liposomes (no protein)

    • Heat-inactivated ZntB

    • Known inhibitors of zinc transport

    • Competing divalent cations (Cd²⁺, Pb²⁺)

  • Data Analysis:

    • Initial rate calculations

    • Michaelis-Menten kinetics analysis

    • Hill coefficient determination (if cooperativity is suspected)

This experimental design allows for systematic investigation of transport kinetics, ion selectivity, and the effects of mutations on ZntB function, following established principles of rigorous experimental design .

How can researchers effectively use site-directed mutagenesis to investigate structure-function relationships in ZntB?

A systematic approach to site-directed mutagenesis studies of ZntB should include these methodological considerations:

  • Target Selection Strategies:

    • Sequence Conservation Analysis: Compare ZntB sequences across species to identify highly conserved residues

    • Structural Predictions: Target residues in predicted zinc-binding sites, transmembrane domains, and conformational hinges

    • Homology-Based Targeting: Use insights from related transporters like YiiP and CorA

    • Charged Residues: Focus on histidine, aspartate, and glutamate residues potentially involved in zinc coordination

  • Mutation Types to Consider:

    • Conservative substitutions (H→N, D→N, E→Q) to maintain structure but eliminate charge

    • Charge reversals (D→K, E→K) to test electrostatic interactions

    • Alanine scanning of transmembrane domains

    • Cysteine substitutions for accessibility studies

  • Functional Assessment Methods:

    • Transport assays in reconstituted systems

    • Zinc binding assays using ITC or fluorescence

    • Conformational change assays

    • Growth complementation in zinc-sensitive bacterial strains

  • Systematic Mutation Matrix:

    RegionTarget ResiduesSuggested MutationsExpected Effect
    Zinc binding sitesHis, Asp, GluH→A, D→N, E→QReduced zinc binding
    Transport pathwayHydrophobic residuesL→A, I→A, V→AAltered transport kinetics
    Transmembrane domainsConserved residuesConservative substitutionsDisrupted membrane integration
    Cytoplasmic domainCharged clustersCharge neutralizationImpaired zinc recognition
  • Integration with Structural Studies:

    • Combine mutagenesis with crystallography or cryo-EM

    • Use EPR spectroscopy with spin-labeled cysteine mutants to track conformational changes

This approach will help delineate the roles of specific residues in zinc binding, transport, and conformational changes during the transport cycle, based on structural insights from related transporters .

What methods are available for monitoring ZntB expression levels and localization in bacterial cells?

Researchers can employ several complementary techniques to monitor ZntB expression levels and localization in bacterial cells:

  • Quantitative Expression Analysis:

    • qRT-PCR: For mRNA expression level quantification of the zntB gene

    • Western Blotting: Using antibodies against ZntB or epitope tags

    • Mass Spectrometry: For absolute quantification of protein levels

    • Flow Cytometry: If fluorescent tags are incorporated

  • Subcellular Localization Methods:

    • Membrane Fractionation: Separation of inner and outer membranes

    • Fluorescence Microscopy: Using fluorescent protein fusions (GFP-ZntB)

    • Immunogold Electron Microscopy: For high-resolution localization

    • Super-resolution Microscopy: For detailed membrane distribution patterns

  • Reporter Systems:

    • Luciferase Reporters: Fused to zntB promoter to monitor transcriptional regulation

    • β-galactosidase Assays: For promoter activity studies

    • Split GFP Complementation: To detect protein-protein interactions

  • In Situ Visualization Protocol:

    • Fix cells with 4% paraformaldehyde

    • Permeabilize selectively (maintaining membrane integrity)

    • Label with fluorescent antibodies or zinc-specific probes

    • Counterstain membranes with appropriate dyes

    • Image using confocal or structured illumination microscopy

  • Functional Localization Assays:

    • Metal-Sensitive Fluorescent Probes: To visualize zinc flux

    • FRET-Based Sensors: To detect conformational changes during transport

When designing these experiments, researchers should consider using appropriate controls, including strains with deleted zntB genes and strains expressing inactive mutants, to validate specificity of the detection methods .

How can structural studies of ZntB inform the design of zinc transport inhibitors with potential antimicrobial applications?

Structural studies of ZntB provide critical insights for rational design of zinc transport inhibitors with potential antimicrobial applications:

  • Structure-Based Drug Design Approach:

    • Target Identification: Leveraging high-resolution structures of ZntB homologs like those from Salmonella enterica (StZntB) at 2.3 Å resolution

    • Binding Site Analysis: Identification of the zinc-binding sites, transport pathway, and conformational change regions

    • In Silico Screening: Virtual screening of compound libraries against identified binding pockets

    • Fragment-Based Design: Building inhibitors based on core structures that bind to key regions

  • Key Structural Features to Target:

    • Zinc Coordination Sites: Design metal-chelating compounds that compete with zinc

    • Funnel Pore Blockage: Molecules that physically obstruct the cylindrical pore formed by the α7 helix

    • Conformational Lock: Compounds that prevent the structural transitions needed for transport

    • Monomer Interface Disruption: Molecules that interfere with oligomerization of ZntB subunits

  • Differentiating from Human Transporters:

    • Focus on structural differences between bacterial ZntB and human zinc transporters

    • Target bacterial-specific features to minimize toxicity

    • Exploit differences in the cytoplasmic domains that show lower conservation

  • Validation Protocols:

    • Binding assays (ITC, surface plasmon resonance)

    • Functional inhibition assays in proteoliposomes

    • Bacterial growth inhibition studies

    • Synergy testing with existing antibiotics

  • Resistance Development Assessment:

    • Directed evolution studies to identify potential resistance mutations

    • Structural analysis of resistant variants

    • Design of second-generation inhibitors addressing resistance mechanisms

This structure-based approach may yield novel antimicrobials that disrupt zinc homeostasis in Shigella and other pathogens, potentially addressing the rising antibiotic resistance challenges .

What is the potential for using recombinant ZntB as an antigen in vaccine development against Shigella sonnei?

Exploration of recombinant ZntB as a vaccine antigen against Shigella sonnei involves several methodological considerations:

  • Immunological Assessment Strategy:

    • Epitope Mapping: Identify immunogenic regions of ZntB

    • Conservation Analysis: Assess sequence conservation across Shigella strains

    • Cross-Reactivity Testing: Evaluate antibody recognition of native ZntB

    • Accessibility Studies: Determine exposure of potential epitopes on bacterial surface

  • Antigen Delivery Platforms:

    • Subunit Vaccines: Using purified recombinant ZntB

    • Outer Membrane Vesicles (OMVs): Natural delivery systems that can incorporate ZntB

    • Recombinant Live Attenuated Vectors: Similar to approaches used with other Shigella antigens

    • DNA Vaccines: Encoding ZntB for in vivo expression

  • Adjuvant Considerations:

    • Aluminum salts for Th2 responses

    • TLR agonists for Th1/Th17 responses

    • Combination adjuvants for balanced immunity

  • Potential Advantages of ZntB-Based Vaccines:

    • Essential protein with limited mutation tolerance

    • Potential cross-protection against multiple Shigella species

    • Possibility of targeting zinc transport to attenuate bacterial virulence

  • Challenges and Limitations:

    • Membrane location may limit accessibility to antibodies

    • Potential conformational epitopes may be lost in recombinant forms

    • Need for appropriate delivery systems to maximize immunogenicity

Recent research with recombinant Shigella flexneri expressing ETEC antigens has demonstrated the feasibility of recombinant approaches for vaccine development, suggesting similar strategies might be applicable for ZntB-based vaccines . The successful use of GM1-capture ELISA to confirm expression in these studies provides a methodological framework for validating recombinant ZntB expression in vaccine candidates .

How do environmental conditions and stress factors influence ZntB expression and function in Shigella sonnei?

The regulation of ZntB expression and function in response to environmental conditions involves complex mechanisms that can be studied using the following methodological approaches:

Understanding these regulatory mechanisms may provide insights into Shigella pathogenesis and reveal potential intervention points, as proper zinc homeostasis is critical for bacterial survival and virulence .

What are the common challenges in purifying functional recombinant ZntB, and how can they be addressed?

Researchers face several challenges when purifying functional recombinant ZntB, which can be addressed using these methodological solutions:

  • Low Expression Yield:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Use specialized expression strains (C41/C43, LEMO21)

      • Optimize codon usage for expression host

      • Lower induction temperature (16-18°C)

      • Consider fusion partners that enhance solubility

      • Test multiple promoter strengths and induction conditions

  • Protein Aggregation and Inclusion Body Formation:

    • Challenge: Improper folding leading to aggregation

    • Solutions:

      • Optimize detergent selection (screen multiple detergents)

      • Include stabilizing additives (glycerol, specific lipids)

      • Consider mild solubilization conditions

      • Explore refolding protocols if inclusion bodies form

      • Use gentle solubilization methods at lower temperatures

  • Loss of Zinc During Purification:

    • Challenge: Zinc dissociation affecting structure and function

    • Solutions:

      • Include 0.1-0.5 mM zinc in all buffers

      • Avoid strong chelating agents (EDTA)

      • Monitor zinc content using atomic absorption spectroscopy

      • Consider zinc reconstitution steps if necessary

  • Protein Instability:

    • Challenge: Degradation or denaturation during purification

    • Solutions:

      • Add protease inhibitors throughout purification

      • Work at 4°C with pre-chilled buffers

      • Minimize purification time

      • Store with 50% glycerol at -20°C for stability

      • Avoid repeated freeze-thaw cycles

  • Oligomerization State Variability:

    • Challenge: Inconsistent formation of physiologically relevant oligomers

    • Solutions:

      • Analyze by native PAGE or size exclusion chromatography

      • Optimize detergent:protein ratio

      • Consider chemical crosslinking to stabilize oligomers

      • Use multi-angle light scattering to confirm oligomeric state

These solutions are based on successful approaches used for similar membrane transporters and should be adapted specifically for ZntB purification .

How can researchers differentiate between the roles of ZntB and other zinc transporters in Shigella sonnei?

Differentiating between the specific roles of ZntB and other zinc transporters in Shigella sonnei requires a multi-faceted experimental approach:

  • Genetic Manipulation Strategies:

    • Single Gene Knockouts: Create ΔzntB and knockouts of other zinc transporters

    • Double/Multiple Knockouts: Generate combinations of transporter deletions

    • Complementation Studies: Restore individual transporters in knockout backgrounds

    • Promoter Swapping: Express transporters under heterologous promoters

    • Domain Swapping: Create chimeric transporters to identify functional domains

  • Expression Pattern Analysis:

    • Condition-Specific Transcriptomics: Compare expression patterns under different zinc conditions

    • Single-Cell Analysis: Study population heterogeneity in transporter expression

    • Temporal Expression: Monitor expression changes over growth phases

    • Spatial Expression: Localize transporters within bacterial cells

  • Functional Discrimination Methods:

    • Transport Directionality: Distinguish influx vs. efflux functions

    • Substrate Specificity: Test transport of zinc vs. other metals

    • Kinetic Parameters: Compare Km and Vmax values

    • Energy Coupling: Identify H⁺-coupled vs. ATP-dependent transport

  • Physiological Role Assessment:

    ConditionMeasurementExpected Outcome for ZntB
    High zincGrowth rates, zinc contentCritical for survival, major contributor to efflux
    Low zincGrowth rates, zinc uptakeMinimal role compared to importers
    pH stresspH-dependent growthMay show pH-sensitive phenotypes due to H⁺ coupling
    Oxidative stressROS sensitivityPotential secondary role in oxidative stress resistance
    Infection modelsColonization, pathogenesisRole in adaptation to host environment
  • Inhibitor-Based Approaches:

    • Develop transporter-specific inhibitors

    • Use in combination with genetic approaches

    • Monitor zinc fluxes in presence of specific inhibitors

These methodological approaches will help delineate the specific contributions of ZntB to zinc homeostasis in S. sonnei and distinguish its functions from other zinc transporters in the bacterial cell .

What are the key considerations for designing experiments to investigate ZntB regulation in response to varying zinc concentrations?

Designing robust experiments to investigate ZntB regulation in response to zinc requires careful consideration of these methodological factors:

  • Zinc Exposure Protocols:

    • Concentration Range: Test physiologically relevant concentrations (0.1-100 μM)

    • Exposure Time: Include both acute (minutes) and chronic (hours/days) exposures

    • Zinc Speciation Control: Account for binding to media components

    • Growth Phase Considerations: Test exponential vs. stationary phase cells

    • Media Composition: Use defined media with controlled zinc levels

  • Expression Analysis Methods:

    • Transcriptional Fusions: zntB promoter fused to reporter genes

    • Translational Fusions: ZntB protein fused to reporters at C-terminus

    • Quantitative RT-PCR: For native mRNA level measurement

    • Proteomics: For absolute protein quantification

    • Ribosome Profiling: To assess translational regulation

  • Regulatory Element Identification:

    • Promoter Dissection: Create series of promoter truncations

    • Site-Directed Mutagenesis: Target predicted regulatory elements

    • DNA-Protein Interaction Assays: EMSA, ChIP-seq, DNA footprinting

    • Regulatory Protein Identification: Affinity purification, mass spectrometry

  • Experimental Design Controls:

    Control TypePurposeImplementation
    Zinc chelationEstablish baselineTPEN or other zinc-specific chelators
    Other metal ionsTest specificityEquimolar concentrations of Cd²⁺, Cu²⁺, etc.
    Known zinc-responsive genesPositive controlsMonitor zntA or other known responders
    Constitutive promotersReference standardsNormalize expression data
    Zinc-insensitive mutantsMechanism validationMutations in regulatory elements
  • Systems Biology Integration:

    • Correlate ZntB regulation with global transcriptome changes

    • Map regulatory networks connecting zinc sensors to transporters

    • Model feedback loops in zinc homeostasis

    • Integrate with metabolic networks affected by zinc availability

  • In Vivo Relevance:

    • Test regulation under infection-relevant conditions

    • Consider host factors that might influence zinc availability

    • Examine tissue-specific zinc levels during infection

This comprehensive experimental design will provide mechanistic insights into how S. sonnei regulates ZntB expression and activity in response to varying zinc conditions, which is crucial for understanding pathogen adaptation to host environments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.