Recombinant Sigma-E factor negative regulatory protein (rseA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
rseA; mclA; c3096; Anti-sigma-E factor RseA; Regulator of SigE; Sigma-E anti-sigma factor RseA; Sigma-E factor negative regulatory protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
rseA
Target Protein Sequence
MQKEQLSALMDGETLDSELLNELAHNPEMQKTWESYHLIRDSMRGDTPEVLHFDISSRVM AAIEEEPVRQPATLIPEAQPAPHQWQKMPFWQKVRPWAAQLTQMGVAACVSLAVIVGVQH YNGQSETSQQPETPVFNTLPMMGKASPVSLGVPSEATANNGQQQQVQEQRRRINAMLQDY ELQRRLHSEQLQFEQAQTQQAAVQVPGIQTLGTQSQ
Uniprot No.

Target Background

Function

This product is an anti-sigma factor for the extracytoplasmic function (ECF) sigma factor, sigma-E (RpoE). ECF sigma factors are maintained in an inactive state by anti-sigma factors until released through regulated intramembrane proteolysis (RIP). RIP is initiated when an extracytoplasmic signal triggers a proteolytic cascade, transmitting information to elicit cellular responses. The process involves periplasmic cleavage (site-1 protease, S1P, DegS), followed by intramembrane cleavage (site-2 protease, S2P, RseP), and finally, cytoplasmic degradation of the anti-sigma factor, thereby releasing sigma-E.

Database Links

KEGG: ecc:c3096

STRING: 199310.c3096

Protein Families
RseA family
Subcellular Location
Cell inner membrane; Single-pass type II membrane protein.

Q&A

What is the functional role of rseA in bacterial stress response pathways?

RseA functions as the anti-sigma factor for σE and plays a central role in envelope stress signal transduction. It spans the inner membrane of the cell envelope and utilizes its cytoplasmic domain to interact with σE. Under normal growth conditions, RseA sequesters σE to the inner membrane, preventing access of σE to its cognate promoters. This sequestration effectively inhibits the transcription of genes in the σE regulon .

When envelope stress occurs, RseA undergoes regulated intramembrane proteolysis (RIP) initiated by periplasmic proteases DegS and RseP. Following this cleavage, the N-terminus of RseA enters the cytoplasm in complex with σE, where it is further processed by the ATP-dependent protease ClpXP. This sequential proteolysis releases σE, allowing it to activate stress response genes .

How do RseA and RseB interact to regulate sigma-E activity?

Binding assays using purified His-tagged RseA periplasmic domain immobilized on Ni-NTA resin have confirmed direct interaction between these proteins. Both domains of RseB interact with the periplasmic domain of RseA (RseA-peri), forming a complex that contributes to the regulation of σE activity .

What methods are most effective for studying RseA-RseB interactions?

For investigating RseA-RseB interactions, several experimental approaches have proven effective:

  • Protein binding assays: Immobilizing His-tagged RseA-peri on Ni-NTA resin and adding equimolar amounts of wild-type or mutant RseB allows for direct assessment of binding interactions. After washing to remove unbound protein, bound complexes can be eluted with imidazole and analyzed by SDS-PAGE .

  • Overlap extension PCR: This technique is valuable for introducing specific mutations (such as cysteine substitutions) into the RseA sequence to investigate the impact on RseB binding. These mutations can be designed based on sequence alignment data to target regions with high similarity between RseA and RseB .

  • Cysteine-mediated disulfide bond formation: This approach helps identify interacting regions by introducing cysteine residues at suspected interaction sites. Formation of disulfide bonds between these cysteines confirms proximity and interaction .

How can post-transcriptional regulation of rseA be experimentally investigated?

Post-transcriptional regulation of rseA, particularly by small RNAs, can be studied using targeted genetic screens. As demonstrated in published research, constructing translational fusions (such as rseA-lacZ) under the control of specific promoters allows for the identification of small RNA regulators. This approach has successfully identified RyhB and FnrS as small RNA activators of the rseA P3 transcript .

For such experiments, researchers typically use a schematic design that includes:

  • The rpoE operon with selected promoters

  • The rseA P3 promoter

  • A translational fusion (e.g., P BAD-rseA27-lacZ)

This experimental setup enables screening of small RNA libraries to identify regulators of rseA expression .

How should enrichment analysis be applied when studying rseA-related pathways?

When analyzing rseA-related pathways and their involvement in stress response networks, researchers can employ the rSEA (simultaneous enrichment analysis) package for comprehensive analysis. This approach combines self-contained and competitive approaches by defining a unified null hypothesis and offers several advantages:

  • It allows both self-contained and competitive testing

  • It enables researchers to choose the type of test after seeing the data

  • It permits postponing the choice of feature-set database until after data review

  • It allows for the definition of feature-sets based on data, such as subsets with specific effect signs or magnitudes

The rSEA package requires feature-wise p-values as input, making it compatible with any omics platform or experimental design. The method operates under the Simes inequality assumption, which allows for dependence between p-values—the same assumption needed for Benjamini-Hochberg FDR control methods .

What are best practices for organizing and presenting rseA experimental data?

For effective organization and presentation of rseA research data, consider implementing structured data tables similar to those used in federal research training grants. A well-formatted data table should include:

  • Clear column headers describing the variables

  • Consistent formatting throughout

  • Appropriate categorization of different types of data

  • Statistical analyses where applicable

When presenting interaction data between RseA and its binding partners, tables should include:

  • Protein regions involved in the interaction

  • Binding affinities (when available)

  • Effects of specific mutations on binding

  • Functional consequences of the interaction

How can structural analysis inform functional studies of rseA?

Structural analysis of rseA provides crucial insights for functional studies. When designing experiments to study structure-function relationships:

  • Identify key domains through sequence alignment and structural prediction

  • Focus on regions with high conservation or similarity to known interacting partners

  • Design targeted mutations in these regions to assess functional impact

  • Use techniques like cysteine-mediated disulfide bond formation to confirm structural hypotheses

The periplasmic domain of RseA is particularly important for interactions with RseB and for sensing envelope stress. Structural studies have shown that regions of high sequence similarity between RseA and RseB (particularly RseA residues 165-191) serve as major binding determinants .

What considerations are important when designing genetic screens for rseA regulators?

When designing genetic screens to identify regulators of rseA, consider the following methodological principles:

  • Construct design: Create translational fusions (such as rseA-lacZ) that accurately reflect the regulation of interest. For example, including the rseA P3 transcript region in the fusion construct allows for identification of factors regulating this specific transcript .

  • Screening strategy: Implement a systematic screening approach, such as testing a library of small RNAs or potential regulatory proteins against your reporter construct.

  • Controls: Include appropriate positive and negative controls to validate the screening system.

  • Validation methods: Prepare secondary validation methods, such as direct binding assays or in vivo expression analysis, to confirm primary screen hits .

How should research proposals for rseA studies be structured?

When preparing research proposals for rseA studies, structure your application following best practices similar to those for NIH training grants:

  • Clear research objectives: Define specific aims related to rseA function, regulation, or interactions.

  • Methodology details: Describe experimental approaches in detail, including protein purification, binding assays, genetic screens, and data analysis methods.

  • Supporting data: Include preliminary data or published findings that support your hypotheses.

  • Data tables: Organize previous findings or preliminary data in clear, well-structured tables that highlight key results and patterns .

  • Research team: Detail the expertise of team members and their roles in the proposed research.

What approaches work best when initiating collaboration on rseA research?

When initiating collaborations for rseA research:

  • Know your mission: Have a clear understanding of your research goals and how the collaboration aligns with them. Consider whether you're looking for specific technical expertise, access to equipment, or theoretical insights .

  • Professional communication: When reaching out to potential collaborators, write professional emails that clearly articulate your interest in their work and the potential for collaboration. Introduce yourself, express your interest in their research on rseA or related proteins, and mention your relevant background or previous work .

  • Preparation for discussions: Be prepared to discuss your specific interests, ask relevant questions about their research, and inquire about potential collaborative opportunities. Have notes ready about your specific questions and goals to ensure productive conversations .

  • Proposal of mutual benefits: Clearly articulate how the collaboration would benefit both parties and contribute to advancing knowledge about rseA function and regulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.