Recombinant Sigmodon ochrognathus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Respiration

NADH-ubiquinone oxidoreductase chain 3 plays a critical role in cellular energy production as part of the electron transport chain's Complex I.

Role in Electron Transport Chain

As a subunit of Complex I, MT-ND3 participates in the transfer of electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane. This process is fundamental to oxidative phosphorylation, the primary mechanism of ATP production in aerobic organisms. The functional activity of this protein directly impacts the efficiency of cellular respiration and energy metabolism .

Significance in Mitochondrial Diseases

Variants in the MT-ND3 gene have been implicated in several mitochondrial disorders. Recent research has identified specific mutations, such as m.10197G>C and m.10191T>C, that significantly impact protein levels and function. These variants are associated with Leigh syndrome and mitochondrial complex I deficiency, characterized by reduced ATP synthesis and compromised energy metabolism . The identification of these disease-associated variants underscores the critical importance of MT-ND3 in maintaining proper mitochondrial function.

Recombinant Production Methods

The production of recombinant Sigmodon ochrognathus MT-ND3 involves several sophisticated biotechnological approaches to express, isolate, and purify the protein for research applications.

Expression Systems

Recombinant MT-ND3 is primarily produced using bacterial expression systems, with Escherichia coli being the most common host organism. The protein is typically expressed with fusion tags, such as polyhistidine (His) tags, to facilitate purification and potentially enhance stability . The expression utilizes the full-length coding sequence (amino acids 1-115) and may incorporate codon optimization to enhance expression efficiency in the bacterial host .

Purification and Formulation

Following expression, the recombinant protein undergoes purification processes that may include affinity chromatography, particularly when His-tagged versions are produced. The purified protein is typically formulated in stabilizing buffers such as Tris-based solutions with additives like glycerol to maintain protein integrity. Commercial preparations often achieve purity levels exceeding 90% as determined by SDS-PAGE analysis . The final product may be provided in various forms, including lyophilized powder or liquid formulations, with specific storage recommendations to preserve activity.

PropertySpecificationReference
Purity>90% (SDS-PAGE)
Storage BufferTris-based buffer, 50% glycerol or 6% Trehalose, pH 8.0
Storage Conditions-20°C/-80°C, avoid repeated freeze-thaw cycles
Working Storage4°C for up to one week
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)

Research Applications

Recombinant MT-ND3 finds applications in various research contexts, including:

  1. ELISA-based assays: The protein is utilized in enzyme-linked immunosorbent assays for detection and quantification of MT-ND3-specific antibodies or for studying protein-protein interactions .

  2. Structure-function studies: As a component of the mitochondrial respiratory chain, recombinant MT-ND3 enables investigations into the structural determinants of electron transport and energy metabolism.

  3. Antibody production: The purified protein serves as an antigen for generating specific antibodies for immunological detection methods.

  4. Biochemical characterization: Recombinant MT-ND3 allows for detailed enzymatic and biophysical studies of its role in the NADH dehydrogenase complex.

Therapeutic Implications and Recent Advances

Recent research involving MT-ND3 has revealed significant potential for therapeutic interventions in mitochondrial diseases.

Novel MT-ND3 Variants and Disease Association

A novel m.10197G>C variant in MT-ND3 has been identified in patients with mitochondrial disorders. Functional analyses demonstrate that this variant significantly reduces MT-ND3 protein levels, leading to deficiencies in complex I assembly and activity, with consequent reduction in ATP synthesis. This finding expands the spectrum of known pathogenic MT-ND3 mutations associated with conditions such as Leigh syndrome .

Innovative Therapeutic Approaches

Researchers have developed promising approaches to address MT-ND3-related mitochondrial dysfunction. A notable technique involves the delivery of mitochondrial genes into mitochondria through codon optimization for nuclear expression and translation by cytoplasmic ribosomes. This approach has shown promising results in rescuing defects arising from MT-ND3 variants .

In this method, mitochondrial targeting sequences are constructed along with codon-optimized MT-ND3 and imported into mitochondria. When applied to patients with m.10197G>C and m.10191T>C missense variants, nuclear expression of the MT-ND3 gene partially restored protein levels and complex I function, with significant improvement in ATP production . This represents a potential therapeutic strategy for mitochondrial diseases caused by MT-ND3 deficiencies.

Comparative Analysis and Evolutionary Context

MT-ND3 is a highly conserved protein across species, reflecting its fundamental role in cellular energy metabolism.

Interspecies Comparison

The MT-ND3 protein from Sigmodon ochrognathus shares significant sequence homology with its counterparts in other mammals, including humans (Homo sapiens) . This conservation suggests functional constraints on protein evolution due to its essential role in mitochondrial respiration. The Yellow-nosed cotton rat (Sigmodon ochrognathus) represents one of several cotton rat species used in research contexts, including respiratory virus studies .

Relevance to Model Systems

Cotton rats, including Sigmodon ochrognathus, serve as important animal models for various research areas, particularly in studies of respiratory viral infections. The availability of recombinant proteins such as MT-ND3 from these species facilitates comparative studies and enhances the utility of these model systems for investigating mitochondrial function in physiological and pathological states .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will then prepare the product according to your specifications.
Lead Time
Delivery times may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Sigmodon ochrognathus (Yellow-nosed cotton rat)
Target Names
Target Protein Sequence
MNLLMALFIDASLSLILISIAFWLPQLNIYTEKAGPYECGFDPLSSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQIPKLSAMMVTSFILISVLALGLMYEWMNKGLEWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. This subunit is crucial for the catalytic activity of Complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of MT-ND3 in mitochondrial complex I?

Complex I (NADH:ubiquinone oxidoreductase) functions as a major source of reactive oxygen species (ROS) in mitochondria, significantly contributing to cellular oxidative stress . The enzyme catalyzes electron transfer from NADH to ubiquinone while facilitating proton translocation across the inner mitochondrial membrane.

Methodological approaches for studying MT-ND3 function include:

  • Site-directed mutagenesis targeting specific residues (e.g., G40K mutation)

  • Functional assays measuring:

    • Electron transfer rates

    • Proton pumping efficiency

    • Superoxide production rates

  • Analysis of protein-protein interactions within complex I

  • Conformational studies using spectroscopic methods

How does the conserved loop region of MT-ND3 regulate complex I activity?

The conserved loop region of MT-ND3 is crucial for the active/deactive state transition of complex I. Research indicates that the G40K mutation in this region can potentially lock complex I in its active conformation . Additionally, the neighboring residue C39 undergoes reversible S-nitrosation, which has been shown to protect against ischemia-reperfusion injury .

To study this regulatory mechanism, researchers typically employ:

  • Targeted mutagenesis of key residues (G40, C39)

  • Comparative analysis of complex I activity in wild-type versus mutant forms

  • Measurement of ROS production under various conditions

  • Assessment of complex I stability using native gel electrophoresis

  • Evaluation of response to metabolic stress and hypoxia/reoxygenation

What techniques can effectively isolate and purify recombinant MT-ND3 protein?

Isolating and purifying recombinant MT-ND3 presents unique challenges due to its hydrophobicity and integration within the multi-subunit complex I. Effective methodological approaches include:

For native protein isolation:

  • Differential centrifugation for mitochondrial enrichment

  • Solubilization with mild detergents (digitonin or n-dodecyl-β-D-maltoside)

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) for intact complex isolation

  • Immunoprecipitation with specific antibodies against MT-ND3

  • Size-exclusion chromatography for complex purification

For recombinant expression:

  • Adeno-associated viral (AAV) vector systems for in vivo expression

  • Addition of mitochondrial targeting sequences

  • Optimization of codon usage for mammalian expression systems

  • Use of inducible promoters to control expression levels

  • Implementation of affinity tags for purification (with careful placement to avoid functional disruption)

How is MT-ND3 involved in superoxide production by complex I?

Complex I is a major source of reactive oxygen species in mitochondria, producing predominantly superoxide rather than hydrogen peroxide . Based on experimental evidence, superoxide formation occurs through the transfer of a single electron from fully reduced flavin to molecular oxygen .

Key methodological findings include:

  • Superoxide production is initiated by NADH addition but not by decylubiquinol

  • NADH-dependent superoxide production is rapidly inhibited by excess NAD+

  • Superoxide generation is not directly affected by decylubiquinone but decreases upon its addition due to NADH consumption and NAD+ generation

  • Importantly, superoxide production is not stimulated during turnover, indicating it is not mediated by a short-lived catalytic intermediate (at least in the absence of proton motive force)

Experimental approaches to study MT-ND3's role in this process include:

  • Spectrophotometric assays measuring superoxide production via reduction of acetylated cytochrome c

  • Site-directed mutagenesis of MT-ND3 (e.g., G40K mutation) with assessment of effects on superoxide generation

  • Comparative analysis of complex I activity and ROS production in different redox states

  • Evaluation of how the active/deactive transition regulated by MT-ND3 influences ROS generation

What are the phylogenetic implications of studying Sigmodon ochrognathus MT-ND3?

For Sigmodon ochrognathus (Yellow-nosed Cotton Rat), MT-ND3 sequence analysis reveals:

  • Species-specific variations that reflect evolutionary adaptations

  • Potential mutation hot spots that affect phylogenetic interpretations

  • Patterns of sequence conservation in functionally critical regions

Methodological considerations for phylogenetic studies include:

  • Awareness that mutation hot spots may create misleading phylogenetic signals

  • The "constant hot spots model correctly fits the data when species are closely related, whereas genera including distantly related species tend to show lower levels of co-occurrence than expected"

  • The need for multi-gene approaches, as demonstrated in Sigmodon studies that combined nuclear and mitochondrial markers

  • Appropriate analytical methods that account for site-specific rate variation

What are the optimal vectors and delivery systems for expressing recombinant S. ochrognathus MT-ND3 in vivo?

Based on recent research, adeno-associated viral (AAV) vectors have proven effective for mitochondrial gene delivery and expression . For recombinant expression of Sigmodon ochrognathus MT-ND3, this approach offers several advantages:

Vector design considerations:

  • Selection of AAV serotypes with appropriate tissue tropism

  • Incorporation of mitochondrial targeting sequences

  • Implementation of regulatory elements for controlled expression

  • Codon optimization for the target expression system

The methodology described in the literature involves:

  • Design of DdCBE (DddA-derived cytosine base editor) pairs containing TALE domains that bind specific mtDNA sequences

  • Packaging of these constructs into AAV vectors

  • Delivery to target tissues in vivo

  • Validation of expression using molecular techniques

Expression efficiency comparison table:

Vector SystemExpression EfficiencyDuration of ExpressionTissue SpecificityOff-target Effects
AAV2/9HighUp to 24 weeks Broad~0.25% mtDNA-wide
AAV2/8Moderate to high3+ weeksLiver preference~0.8% in neonates
LentiviralVariablePotentially permanentLimitedIntegration concerns
AdenoviralHigh but transient1-2 weeksBroadImmunogenic response

How can mitochondrial base editing be applied to study MT-ND3 functional domains?

The recent development of mitochondrial base editing technology provides powerful tools for studying MT-ND3 function. The methodology described in the search results involves DdCBE (DddA-derived cytosine base editor) pairs that can introduce precise C-to-T substitutions in mitochondrial DNA .

Key methodological components:

  • TALE domains designed to bind specific mtDNA sequences flanking the target site

  • Split DddA toxin fragments that catalyze cytosine deamination when brought into proximity

  • Careful selection of target sites based on the TC context preference of the editor

  • Delivery systems, typically AAV vectors, for in vivo applications

This approach allows researchers to create specific mutations in MT-ND3, such as the G40K mutation located in the conserved loop involved in complex I active/deactive transition . The experimental workflow involves:

  • Design of DdCBE pairs targeting specific regions of MT-ND3

  • Validation in cell culture systems (e.g., NIH/3T3 cells)

  • Analysis of editing efficiency using sequencing methods

  • Assessment of off-target editing

  • In vivo delivery using appropriate vector systems

  • Functional characterization of the resulting mutations

Editing efficiency table for different DdCBE configurations:

DdCBE PairTarget SequencePrimary Edit PatternEditing EfficiencyOff-target Rate
DdCBE-Nd3-9577-1C12 & C13 in MT-Nd3G40K (~83%) HighVariable
DdCBE-Nd3-9577-2C12 & C13 in MT-Nd3G40K (~53%), G40E (45.5%) HighVariable
DdCBE-Nd3-9577-3C12 & C13 in MT-Nd3Pattern similar to pair 1 HighVariable
DdCBE-Nd3-9577-4C12 & C13 in MT-Nd3Low efficiency LowMinimal

What are the implications of the G40K mutation in MT-ND3 for complex I activity and disease models?

The G40K mutation in MT-ND3 affects a highly conserved region involved in the active/deactive state transition of complex I . Research indicates that this mutation has significant functional implications:

  • High G40K heteroplasmy is expected to "result in mitochondrial dysfunction by permanently locking complex I in active confirmation"

  • The mutation is located near residue C39, which undergoes S-nitrosation that protects against ischemia-reperfusion injury

  • The G40K mutant could potentially alter the exposure of Cys39, affecting its protective role

These properties make the G40K mutation a valuable tool for studying:

  • Regulation of complex I activity

  • Mechanisms of mitochondrial dysfunction

  • Protective responses to oxidative stress

  • Potential therapeutic approaches for ischemia-reperfusion injury

Methodological approaches for characterizing the G40K mutation:

  • Generation of cellular and animal models expressing MT-ND3 G40K

  • Measurement of complex I activity parameters:

    • NADH oxidation rates

    • Ubiquinone reduction

    • Proton pumping

    • ROS production

  • Assessment of mitochondrial membrane potential

  • Oxygen consumption measurements

  • Cell survival studies under stress conditions

  • Ischemia-reperfusion models to evaluate protection mechanisms

How do mutation hot spots in MT-ND3 affect phylogenetic analyses and molecular evolution studies?

Mitochondrial DNA, including MT-ND3, exhibits high levels of homoplasy (phylogenetic conflict between sites) that complicates evolutionary analyses . The search results indicate that mutation hot spots, rather than recombination, likely explain much of this phenomenon in mammalian mitochondrial DNA .

Key findings relevant to MT-ND3 research:

  • Analysis of mammalian mitochondrial genes shows "significant co-occurrence of synonymous polymorphisms among closely related species"

  • Correlation exists between "site-specific levels of variability within humans and between Hominoidea species"

  • These patterns confirm that "mutation hot spots actually exist in mammalian mitochondrial coding regions"

  • For some genera, including Sigmodon, there is "no significant co-occurrence" of polymorphisms despite strong homoplasy

The methodological implications for studying MT-ND3 evolution include:

  • Need for awareness of potential hot spot-induced homoplasy

  • Implementation of appropriate evolutionary models that account for site-specific rate variation

  • Recognition that the constant hot spots model fits better for closely related species than for distantly related taxa

  • Utilization of multiple genes (both mitochondrial and nuclear) for more robust phylogenetic reconstruction

What methodological approaches can address the challenges of studying superoxide production by recombinant MT-ND3 variants?

Studying superoxide production by recombinant MT-ND3 variants requires careful experimental design to ensure physiologically relevant results. Based on the search results, several methodological approaches are effective:

1. Detection systems for superoxide production:

  • Reduction of acetylated cytochrome c, which provides a specific measure of superoxide production

  • Inclusion of controls to distinguish direct reduction of cytochrome c from superoxide-mediated reduction

  • Use of specific inhibitors to isolate the contribution of complex I

2. Substrate and inhibitor manipulations:

  • NADH addition stimulates superoxide production

  • NAD+ inhibits superoxide production

  • Decylubiquinone affects superoxide production indirectly by consuming NADH and generating NAD+

  • Specific inhibitors like piericidin A can isolate complex I contribution in membrane systems

3. Experimental conditions for isolated complex I versus membrane systems:

  • Addition of stigmatellin (0.1 μM) to inhibit complex III in membrane assays

  • Use of piericidin A (0.5 μM) to inhibit complex I when needed

  • Standard conditions of 30 μM NADH, 200 μM decylubiquinone, 1 mM NAD+, 32°C, pH 7.5

4. Validation of isolated complex I as an experimental system:

  • The specific activity of complex I in membranes is approximately 17% that of isolated complex I

  • This ratio agrees with the reported values for complex I to other respiratory complexes in bovine heart mitochondrial membranes (20 ± 4% by mass)

  • These findings confirm that "the catalytic properties of the isolated enzyme are representative of the membrane-bound enzyme"

5. Considerations for recombinant MT-ND3 variants:

  • Site-directed mutagenesis to introduce specific changes (e.g., G40K mutation)

  • Assessment of complex I assembly and stability with modified MT-ND3

  • Careful control of expression levels to avoid artifacts

  • Comparative analysis with wild-type complex I

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.