Recombinant Silene pratensis Chlorophyll a-b binding protein, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Chlorophyll a-b binding protein, chloroplastic; LHCII type I CAB; LHCP; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-205
Protein Length
Full Length of Mature Protein
Species
Silene latifolia subsp. alba (White campion) (Lychnis alba)
Target Protein Sequence
RRTIKSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNREL EVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSI LAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is the protein structure of Chlorophyll a-b binding protein related to its function in chloroplasts?

The protein structure of Chlorophyll a-b binding protein is directly tied to its function in light-harvesting complexes within chloroplasts. Structural analysis using techniques such as circular dichroism and nuclear magnetic resonance spectroscopy reveals that the protein contains specific domains that facilitate chlorophyll binding and protein-protein interactions within the thylakoid membrane.

The protein contains hydrophobic regions that anchor it within the thylakoid membrane, while other regions interact with chlorophyll molecules. Understanding this structure-function relationship is crucial for studies investigating photosynthetic efficiency and energy transfer mechanisms .

What are the recognized synonyms and identifiers for this protein in scientific literature?

When conducting literature searches, researchers should be aware of the following synonyms and identifiers:

Identifier TypeValue
Protein NameChlorophyll a-b binding protein, chloroplastic
SynonymsLHCII type I CAB; LHCP; Fragment
UniProt IDP12332
SpeciesSilene latifolia subsp. alba (White campion) (Lychnis alba)

Using these alternative names in database searches ensures comprehensive retrieval of relevant literature and prevents overlooking important research findings .

What expression systems are most effective for producing functional recombinant Silene pratensis Chlorophyll a-b binding protein?

E. coli is commonly used for expression of Recombinant Silene pratensis Chlorophyll a-b binding protein. For optimal expression, the following methodological approach is recommended:

  • Clone the gene sequence corresponding to amino acids 37-205 (mature protein) into an expression vector containing an N-terminal His-tag

  • Transform the construct into an appropriate E. coli strain (BL21(DE3) or similar)

  • Induce expression using optimized IPTG concentration and temperature

  • Lyse cells and purify using nickel affinity chromatography

This approach yields recombinant protein with greater than 90% purity as determined by SDS-PAGE, suitable for various biochemical and structural analyses .

What are the optimal storage conditions for preserving the activity of purified Silene pratensis Chlorophyll a-b binding protein?

For maximum stability and retention of biological activity, the following storage protocol is recommended:

  • Store the lyophilized powder at -20°C to -80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

The protein is stable in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose. Repeated freeze-thaw cycles significantly reduce protein stability and should be avoided .

How can researchers verify the proper folding and functional integrity of recombinant Chlorophyll a-b binding protein?

Verification of proper folding and functional integrity should employ multiple complementary techniques:

  • Spectroscopic analysis: Circular dichroism (CD) spectroscopy can confirm secondary structure elements, particularly the alpha-helical content characteristic of properly folded protein

  • Chlorophyll binding assay: Measure the protein's ability to bind chlorophyll molecules using fluorescence spectroscopy

  • Size exclusion chromatography: Verify the oligomeric state and absence of aggregation

  • Functional reconstitution: Assess the ability to integrate into artificial membrane systems or liposomes

Structural assessment through CD has revealed that the protein may exhibit structural flexibility, with potential for forming amphipathic helices under certain conditions, which is important for its functionality .

How does the transit peptide of Silene pratensis Chlorophyll a-b binding protein direct its localization to chloroplasts?

The chloroplast targeting mechanism of Silene pratensis proteins involves a complex process mediated by transit peptides:

  • In aqueous environments, the transit peptide remains largely unstructured, with only minor propensity toward helix formation from Val-9 to Ser-12 and from Gly-30 to Ser-40

  • Upon interaction with membrane-mimicking environments (such as those containing 50% trifluoroethanol), the peptide adopts a more structured conformation

  • The N-terminal region forms an amphipathic helix with hydrophobic and hydroxylated amino acids on opposite sides

  • The C-terminal region forms a separate helix comprising amino acids Met-29 to Gly-50, with a destabilization at Gly-39

This structural flexibility is critical for the transit peptide's function, allowing it to interact with lipids in the chloroplast outer membrane during import. The import process itself involves recognition by receptor proteins on the chloroplast surface, followed by translocation across the envelope membranes .

What are the key structural features of chloroplast transit peptides that determine their targeting efficiency?

Several structural features determine the targeting efficiency of chloroplast transit peptides:

  • Amphipathicity: The ability to form amphipathic helices with distinct hydrophobic and hydrophilic faces

  • Flexibility: The maintenance of structural flexibility allows adaptation to different environments during import

  • Charge distribution: A net positive charge facilitates interaction with the negatively charged chloroplast outer membrane

  • Recognition motifs: Specific amino acid sequences recognized by components of the chloroplast import machinery

Studies using circular dichroism and nuclear magnetic resonance spectroscopy have demonstrated that the Silene pratensis transit peptide lacks ordered tertiary structure but can form independent N- and C-terminal helices in membrane-mimicking environments. This structural flexibility appears to be a common feature among chloroplast targeting sequences and is crucial for their function .

How can researchers design optimized signal peptides for targeting recombinant proteins to specific chloroplast compartments?

Designing optimized signal peptides for chloroplast targeting requires a systematic approach:

  • Analyze natural transit peptides: Study the structure and properties of effective transit peptides like those from Silene pratensis

  • Incorporate self-cleavage sites: Include self-cleavage sites like PCS1 (Peptide of self-cleavage site 1) to ensure removal of the transit peptide after import

  • Add C-terminal positioning signals: Sixteen amino acids from the blue pigment precursor protein of Silene pratensis can enhance chloroplast targeting

  • Validate localization: Use transient expression, Western blot analysis, and full-spectrum scanning to verify proper localization

Research has demonstrated that the potato rbcS signal peptide must be extended to 80 amino acids for accurate and efficient chloroplast localization of proteins like tartronate semialdehyde reductase (EcTSR). Additionally, specific signal peptides can target proteins to different chloroplast compartments or even to the outer membrane surface, as shown with malate synthase (CmMS) .

What are the most reliable methods for studying protein-protein interactions involving Chlorophyll a-b binding protein in photosynthetic complexes?

Several complementary approaches can be used to study protein-protein interactions involving Chlorophyll a-b binding protein:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag or the protein itself to pull down interaction partners

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in vivo

  • Surface Plasmon Resonance (SPR): For quantitative analysis of binding kinetics

  • Crosslinking coupled with mass spectrometry: To identify interaction interfaces

  • Blue Native PAGE: To preserve native protein complexes for analysis

When designing these experiments, researchers should consider the membrane-associated nature of the protein and use appropriate detergents for solubilization. Controls should include analysis of non-specific binding and validation of results using multiple techniques .

How can site-directed mutagenesis be used to investigate the functional domains of Silene pratensis Chlorophyll a-b binding protein?

Site-directed mutagenesis provides valuable insights into structure-function relationships:

  • Target conserved residues: Identify highly conserved amino acids across species using multiple sequence alignment

  • Focus on domain boundaries: Target residues at the interfaces between predicted structural domains

  • Investigate chlorophyll binding sites: Mutate residues predicted to interact directly with chlorophyll molecules

  • Analyze membrane integration: Modify hydrophobic residues involved in membrane anchoring

After generating mutants, assess their functional impact through:

  • Chlorophyll binding assays

  • Protein stability measurements

  • Membrane integration analysis

  • In vivo localization studies using fluorescent protein fusions

This approach has been successful in characterizing functional domains in related light-harvesting proteins and can reveal critical insights into the function of Silene pratensis Chlorophyll a-b binding protein .

What techniques are most effective for studying the structural flexibility of chloroplast transit peptides?

The structural flexibility of chloroplast transit peptides can be investigated using:

  • Circular Dichroism (CD) spectroscopy: To assess secondary structure content in different environments

  • Nuclear Magnetic Resonance (NMR) spectroscopy: For detailed structural analysis at atomic resolution

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To probe conformational dynamics

  • Molecular Dynamics Simulations: To model structural transitions in different environments

Studies of the Silene pratensis preferredoxin transit peptide have utilized CD and NMR spectroscopy to demonstrate that it is largely unstructured in water but forms distinct helical regions in membrane-mimicking environments (50% trifluoroethanol). This approach revealed the formation of structurally independent N- and C-terminal helices, with the N-terminal helix exhibiting amphipathic properties important for membrane interaction .

How can recombinant Chlorophyll a-b binding protein be used to improve photorespiratory bypass pathways in crop plants?

Recombinant Chlorophyll a-b binding proteins can contribute to photorespiratory bypass engineering through:

  • Optimization of chloroplast targeting: Using insights from studies on signal peptides to precisely localize metabolic enzymes to chloroplasts

  • Enzyme stabilization: Co-expression with binding proteins to enhance stability of photorespiratory bypass enzymes

  • Metabolic channeling: Creating fusion proteins to facilitate substrate channeling between enzymes

  • Thylakoid membrane organization: Modifying light harvesting to complement metabolic engineering efforts

Research has demonstrated that targeting precision is critical for photorespiratory bypass success. For example, tartronate semialdehyde reductase (EcTSR) requires specific signal peptide extensions for accurate chloroplast localization, while other enzymes like malate synthase (CmMS) may localize to the chloroplast outer membrane surface. These targeting differences significantly impact enzyme function and pathway efficiency .

What are the challenges and solutions for expressing functional plant chloroplast proteins in heterologous systems?

Expression of functional plant chloroplast proteins in heterologous systems faces several challenges:

ChallengeSolution
Proper foldingUse specialized E. coli strains with enhanced folding capacity; co-express chaperones
Disulfide bond formationUtilize strains engineered for disulfide bond formation (e.g., SHuffle)
Post-translational modificationsExpress in eukaryotic systems when modifications are essential
Membrane protein solubilityOptimize detergent selection; use fusion partners to enhance solubility
Removal of transit peptidesExpress mature protein (aa 37-205) to avoid interference from transit sequences

For Silene pratensis Chlorophyll a-b binding protein, expression in E. coli using the mature protein sequence (amino acids 37-205) with an N-terminal His-tag has proven successful, yielding protein with greater than 90% purity suitable for various applications .

How does the structure and function of Silene pratensis Chlorophyll a-b binding protein compare with homologous proteins from other plant species?

Comparative analysis of Chlorophyll a-b binding proteins across species reveals:

  • Sequence conservation: High conservation in chlorophyll-binding regions and membrane-spanning domains

  • Structural variations: Species-specific differences in loop regions and surface-exposed residues

  • Transit peptide diversity: Significant variation in transit peptide sequences despite functional conservation

  • Evolutionary adaptations: Modifications related to specific environmental conditions and photosynthetic requirements

Research on Silene species has provided valuable insights into adaptation mechanisms, as seen in studies of S. dioica and S. latifolia that investigated stress responses and genetic differentiation . These comparative approaches can inform our understanding of how Chlorophyll a-b binding proteins have evolved to optimize photosynthetic efficiency in different environmental contexts.

What are the most common issues encountered during recombinant expression of Silene pratensis Chlorophyll a-b binding protein, and how can they be resolved?

Researchers frequently encounter several challenges when expressing this protein:

ProblemCauseSolution
Low expression yieldToxicity to host cellsUse tightly regulated expression systems; lower induction temperature
Protein insolubilityMembrane protein characteristicsInclude appropriate detergents during lysis; use fusion tags to enhance solubility
Protein degradationProteolytic activityAdd protease inhibitors; use protease-deficient host strains
Improper foldingLack of chloroplast-specific chaperonesCo-express molecular chaperones; optimize growth conditions
Poor purification efficiencyInaccessible His-tagTry alternative tag positions or types; optimize purification buffers

When expressing the recombinant protein in E. coli, using the mature protein sequence (amino acids 37-205) and including 6% trehalose in the storage buffer has been shown to enhance stability. Additionally, avoiding repeated freeze-thaw cycles and storing working aliquots at 4°C for no more than one week helps maintain protein integrity .

How can researchers troubleshoot problems with chloroplast localization when using transit peptides in transgenic studies?

When encountering issues with chloroplast targeting in transgenic studies, the following troubleshooting steps are recommended:

  • Verify transit peptide length: Ensure the transit peptide is of sufficient length (often 80 amino acids is required for efficient targeting)

  • Examine fusion protein design: Check that the transit peptide is properly fused to the protein of interest without disrupting key motifs

  • Include self-cleavage sites: Incorporate self-cleavage sites like PCS1 to ensure removal of the transit peptide after import

  • Validate with multiple techniques: Use transient expression, Western blot analysis, and full-spectrum scanning to confirm localization

  • Compare with known functional transit peptides: Include positive controls with well-characterized transit peptides

Research has shown that the potato rbcS signal peptide must be extended to 80 amino acids for accurate chloroplast localization of some proteins, while the addition of sixteen amino acids from the blue pigment precursor protein of Silene pratensis to the C-terminal of a signal peptide can enhance targeting efficiency .

What analytical techniques can resolve discrepancies in experimental results when studying Chlorophyll a-b binding protein function?

When faced with inconsistent or contradictory results regarding Chlorophyll a-b binding protein function, these analytical approaches can help resolve discrepancies:

  • Multiple spectroscopic methods: Combine UV-Vis, fluorescence, and circular dichroism to obtain complementary structural information

  • Size heterogeneity analysis: Use size exclusion chromatography and dynamic light scattering to assess protein aggregation

  • Mass spectrometry: Verify protein identity, detect post-translational modifications, and identify contaminants

  • Functional reconstitution: Test protein function in reconstituted systems mimicking the native environment

  • Comparative analysis: Benchmark results against well-characterized homologues from other plant species

When analyzing structural properties, consider that transit peptides exhibit environment-dependent conformational changes. For instance, the Silene pratensis preferredoxin transit peptide is unstructured in water but forms helices in membrane-mimicking conditions, which may explain variability in experimental results depending on buffer conditions .

What emerging technologies could advance our understanding of Chlorophyll a-b binding protein structure and function?

Several cutting-edge technologies show promise for deepening our understanding of this protein:

  • Cryo-electron microscopy (Cryo-EM): For high-resolution structural analysis of the protein in its native membrane environment

  • Single-molecule FRET: To study conformational dynamics and protein-protein interactions in real-time

  • Advanced mass spectrometry approaches: Including cross-linking MS and native MS for structural analysis

  • Computational approaches: Including AlphaFold2 and other AI-based structure prediction methods

  • Optogenetics: For precise temporal control of protein function in vivo

These technologies could help resolve longstanding questions about how the protein's structure relates to its function in light harvesting and energy transfer, particularly regarding the dynamic interactions between the protein, chlorophyll molecules, and other components of the photosynthetic apparatus .

How might synthetic biology approaches utilize engineered variants of Chlorophyll a-b binding protein?

Synthetic biology offers exciting possibilities for utilizing engineered variants:

  • Designer light-harvesting complexes: Creating custom light-harvesting systems with altered spectral properties

  • Bioenergy applications: Engineering proteins for improved light capture efficiency in biofuel production

  • Biosensors: Developing sensors for environmental monitoring based on conformational changes in the protein

  • Scaffold proteins: Using modified binding proteins as scaffolds for organizing metabolic pathways

  • Photo-protection mechanisms: Engineering variants with enhanced photoprotective capabilities

The inherent structural flexibility of the protein's transit peptide, as revealed by circular dichroism and NMR studies, suggests potential for engineering variants with modified targeting properties or altered structural stability. Such modifications could be valuable for various synthetic biology applications .

What are the potential applications of understanding chloroplast protein targeting mechanisms for crop improvement?

Knowledge of chloroplast protein targeting has significant implications for crop improvement:

  • Enhanced photosynthetic efficiency: Precise localization of engineered proteins to optimize carbon fixation

  • Stress tolerance: Targeting of protective proteins to specific chloroplast compartments

  • Photorespiratory bypass engineering: Improved localization of enzymes for alternative photorespiratory pathways

  • Metabolic engineering: Creation of novel metabolic pathways within chloroplasts

  • Protein accumulation: High-level production of valuable proteins in chloroplasts

Research on transit peptides from Silene pratensis and other species has revealed that targeting precision significantly impacts enzyme function. For example, tartronate semialdehyde reductase requires specific signal peptide extensions for accurate chloroplast localization, which is critical for successful photorespiratory bypass engineering. Similarly, understanding how malate synthase localizes to the chloroplast outer membrane could inform strategies for engineering metabolism at membrane interfaces .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.