Recombinant Silicibacter pomeroyi Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Silicibacter pomeroyi CobD

Silicibacter pomeroyi is a marine bacterium known for its significant role in oceanic biogeochemical processes . The CobD protein in S. pomeroyi is involved in cobalamin (vitamin B12) biosynthesis . Cobalamin biosynthesis is crucial for various metabolic functions in bacteria . Specifically, CobD is an enzyme that catalyzes the decarboxylation of L-threonine O-3-phosphate to yield (R)-1-amino-2-propanol O-2-phosphate .

Function of CobD in Cobalamin Biosynthesis

CobD functions as L-threonine-O-3-phosphate decarboxylase . This enzyme plays a vital role in the synthesis of (R)-1-amino-2-propanol O-2-phosphate, which is a key intermediate in cobalamin biosynthesis . The reaction catalyzed by CobD is essential for the conversion of adenosylcobyric acid to adenosylcobinamide . CobD is considered part of a new class of pyridoxal phosphate-dependent decarboxylases .

Importance in Marine Bacteria

Silicibacter pomeroyi requires cobalamin for various metabolic processes . CobD's function in cobalamin biosynthesis contributes to the bacterium's ability to thrive in marine environments . The capacity to synthesize cobalamin de novo can provide a symbiotic advantage to algae auxotrophic for vitamin B12 .

Genomic Context

The genome of Silicibacter pomeroyi contains genes that facilitate its association with plankton and suspended particles . The cobD gene is part of the cobalamin biosynthesis pathway within the S. pomeroyi genome . The R. pomeroyi DSS-3 genome has been updated with new information related to genes responsible for carbon, nitrogen, sulfur, and metal uptake and metabolism .

Role in Cobamide Remodeling

Some bacteria, like Vibrio cholerae, use CobS homologs to remodel cobamides directly, allowing them to convert pseudocobalamin to cobalamin . CobS is involved in attaching ribosylated lower ligands to the aminopropanol arm during cobamide biosynthesis .

CobD Homologs and Phylogenetic Analysis

BluD is homologous to AdoCbi-P synthase (CbiB) of S. enterica . BluC is homologous to L-Thr-P decarboxylase (CobD) of S. enterica . Phylogenetic analysis reveals distinct clusters of organisms synthesizing either cobaltochelatase or BluE homologues, indicating different pathways for AdoCba biosynthesis .

Experimental Studies and Findings

Experimental studies have validated the function of genes involved in carbon, nitrogen, sulfur, and metal uptake and metabolism in R. pomeroyi DSS-3 . Proteomic studies have identified novel open reading frames and corrected start sites of genes, enhancing genomic annotation .

Key Metabolic Pathways

R. pomeroyi DSS-3 is involved in the marine sulfur cycle, controlling the flux of volatile sulfur to the atmosphere . It metabolizes dimethylsulfoniopropionate (DMSP) and other sulfur compounds . The bacterium also processes organic nitrogen compounds like taurine and N-acetyltaurine .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
cobD; SPO3225; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi)
Target Names
cobD
Target Protein Sequence
MSTALLLGFAMLLDAALGEPEWLWSRLRHPAVLIGDIISVLDDELNEGGHRRLKGVAVTA ILAVGALSVGALLSLLGPVAEVLICAILLAQKSLAGHVADVADALRLSLPEARRSVARIV SRDTATMSEPQVARAAIESAAENLSDGVIAPAFWFLVGGLPGLLLYKTINTADSMVGYMN ERYAQFGWAAARLDDLLNLIPARLTCGMIVLLSNGWRHWRGIVEDAQRHISPNAGWPEAA MARALNIALAGPRSYHGEIRHLAWVNEEGRKEIGPREIERAVTLLWQVWALALGLTLTLV ALAAIF
Uniprot No.

Target Background

Function

CobD catalyzes the addition of aminopropanol to the F carboxylic group of cobyric acid, converting it to cobinamide.

Database Links

KEGG: sil:SPO3225

STRING: 246200.SPO3225

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Silicibacter pomeroyi Cobalamin biosynthesis protein CobD and what is its function?

The Cobalamin biosynthesis protein CobD (cobD) from Silicibacter pomeroyi (also known as Ruegeria pomeroyi) is a 306-amino acid enzyme critical to the vitamin B12 (cobalamin) biosynthetic pathway. CobD functions as an L-threonine-phosphate (L-Thr-P) decarboxylase (EC 4.1.1.81) in the late-cobalt-insertion pathway of cobalamin biosynthesis . It catalyzes the conversion of L-Thr-P to ethanolamine phosphate (EA-P), which becomes part of the nucleotide loop structure in the final cobalamin molecule . This enzyme is homologous to CobD in other bacteria such as S. enterica, but is part of a separate pathway found in Rhodobacterales, which have evolved a unique strategy for cobalamin biosynthesis .

What is the genomic context of the cobD gene in Silicibacter pomeroyi?

The cobD gene in Silicibacter pomeroyi is located in the chromosome and is designated as SPO3225 in the ordered locus names . S. pomeroyi has a genome consisting of a main chromosome (4,109,442 base pairs) and a megaplasmid (491,611 base pairs) . The genome sequence reveals that S. pomeroyi possesses a complete set of genes for cobalamin biosynthesis, reflecting its adaptation to the marine environment where vitamin B12 is often a limiting nutrient . The genomic context suggests that cobD is part of a gene cluster involved in cobalamin biosynthesis, which is consistent with its function in vitamin B12 production pathway.

What is the taxonomic classification of Silicibacter pomeroyi and why is it significant for cobD research?

Silicibacter pomeroyi (now reclassified as Ruegeria pomeroyi) has the following taxonomic classification:

Taxonomic LevelClassification
DomainBacteria
PhylumPseudomonadota
ClassAlphaproteobacteria
OrderRhodobacterales
FamilyRhodobacteraceae
GenusRuegeria
SpeciesRuegeria pomeroyi

This classification is significant because R. pomeroyi is a member of the marine Roseobacter clade, which comprises approximately 10-20% of coastal and oceanic mixed-layer bacterioplankton . As such, studying its cobalamin biosynthesis pathway provides insights into how these ecologically important marine bacteria acquire essential cofactors in nutrient-limited environments. R. pomeroyi was also the first heterotrophic marine bacterium to have its genome fully sequenced, making it an important model organism for understanding marine bacterial metabolism .

How is recombinant S. pomeroyi CobD protein typically expressed and purified for research purposes?

Recombinant S. pomeroyi CobD protein is typically expressed as a His-tagged fusion protein in E. coli expression systems . The general methodology involves:

  • Cloning: The full-length cobD gene (coding for amino acids 1-306) is amplified from S. pomeroyi genomic DNA and cloned into an expression vector with an N-terminal His-tag .

  • Expression: The recombinant plasmid is transformed into an E. coli expression strain. Protein expression is induced under appropriate conditions (typically using IPTG for T7-based expression systems) .

  • Purification: The protein is purified using immobilized metal affinity chromatography (IMAC) taking advantage of the His-tag. This typically results in >90% purity as determined by SDS-PAGE .

  • Storage: The purified protein is stored in a Tris-based buffer containing 50% glycerol at -20°C for short-term storage or -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week .

Researchers should note that repeated freezing and thawing is not recommended as it may affect protein activity and stability .

How does S. pomeroyi CobD differ from homologous proteins in other bacteria?

S. pomeroyi CobD belongs to a distinct class of CobD proteins found specifically in Rhodobacterales that have adopted the late-cobalt-insertion pathway for cobalamin biosynthesis . Key differences include:

  • Pathway specificity: While functionally similar to CobD in organisms like Salmonella enterica, the S. pomeroyi CobD is part of a pathway specifically adapted for marine environments where cobalamin is often limited .

  • Sequence divergence: Comparative analysis shows that CobD proteins from Rhodobacterales form a phylogenetically distinct cluster separate from those in organisms using the early-cobalt-insertion pathway (like those containing CbiK or CbiX cobaltochelatases) .

  • Functional integration: In S. pomeroyi, CobD works in concert with other proteins unique to Rhodobacterales, like BluE, which is a specialized L-threonine kinase specifically adapted for cobalamin biosynthesis in these marine bacteria .

  • Structural features: The S. pomeroyi CobD may have specific structural adaptations for functioning in marine conditions, though detailed structural comparison with homologs from terrestrial bacteria would require further analysis.

These differences highlight evolutionary adaptations specific to the marine environment and the specialized metabolic strategies employed by Rhodobacterales for cobalamin biosynthesis .

What experimental approaches can be used to assess the enzymatic activity of recombinant S. pomeroyi CobD?

To assess the enzymatic activity of recombinant S. pomeroyi CobD, researchers can employ several methodological approaches:

  • Spectrophotometric Assays: Monitor the decarboxylation of L-Thr-P to EA-P by:

    • Coupling the reaction to NADH oxidation through auxiliary enzymes

    • Measuring CO₂ release using pH-sensitive indicators

  • Chromatographic Analysis:

    • HPLC or LC-MS to quantify substrate depletion and product formation

    • TLC with appropriate visualization reagents for preliminary analysis

  • Radioisotope-Based Assays:

    • Using ¹⁴C-labeled L-Thr-P and measuring release of ¹⁴CO₂

    • Scintillation counting of reaction products after separation

  • Complementation Studies:

    • Express recombinant S. pomeroyi CobD in cobD-deficient bacterial strains to assess functional complementation

    • Measure restoration of cobalamin biosynthesis in these strains

  • Substrate Specificity Analysis:

    • Test activity with structural analogs of L-Thr-P

    • Determine kinetic parameters (Km, kcat, and kcat/Km) for different substrates

For accurate activity measurements, researchers should ensure:

  • Proper buffer conditions (typically pH 7.5-8.0)

  • Presence of any required cofactors (PLP is likely needed)

  • Temperature control (optimal temperature for marine bacterial enzymes may differ from E. coli enzymes)

  • Absence of inhibitory compounds in the reaction mixture

How does the S. pomeroyi CobD function within the context of the complete cobalamin biosynthetic pathway in Rhodobacterales?

S. pomeroyi CobD functions as an integral component within a specialized version of the cobalamin biosynthetic pathway found in Rhodobacterales:

This specialized pathway in Rhodobacterales represents an adaptation to marine environments where efficient cobalamin biosynthesis provides an ecological advantage .

What structural features might explain the catalytic mechanism of S. pomeroyi CobD?

While a specific crystal structure of S. pomeroyi CobD has not been reported in the provided search results, insights into its structural features and catalytic mechanism can be inferred from:

  • Sequence Analysis: As a PLP-dependent decarboxylase, S. pomeroyi CobD likely contains:

    • A PLP binding site with a conserved lysine residue for Schiff base formation

    • A substrate binding pocket optimized for L-Thr-P

    • Catalytic residues for stabilizing reaction intermediates

  • Homology Modeling: Structural predictions based on related enzymes suggest:

    • A fold characteristic of PLP-dependent enzymes, possibly with α/β architecture

    • Dimer or higher oligomeric states to form complete active sites

    • Surface features adapted to marine conditions (e.g., salt tolerance)

  • Functional Domains:

    • N-terminal domain potentially involved in membrane association

    • Core catalytic domain containing the PLP cofactor binding site

    • C-terminal domain potentially involved in protein-protein interactions with other pathway enzymes

  • Catalytic Mechanism: The likely reaction proceeds via:

    • PLP-substrate Schiff base formation

    • Carboxyl group delocalization

    • Decarboxylation with protonation at Cα

    • Hydrolysis to release EA-P and regenerate enzyme-PLP complex

To fully elucidate these structural features, experimental approaches such as X-ray crystallography, cryo-EM, or NMR spectroscopy would be necessary, potentially using the available recombinant protein preparations .

What are the implications of studying S. pomeroyi CobD for understanding marine biogeochemical cycles?

Studying S. pomeroyi CobD has significant implications for understanding marine biogeochemical cycles:

  • Cobalamin Availability in Marine Ecosystems:

    • Cobalamin is a limiting nutrient in marine environments

    • Understanding its biosynthesis pathway helps explain how key marine bacteria secure this essential cofactor

    • The efficiency of CobD and the complete pathway affects cobalamin availability to the broader marine community, including algae

  • Role in Carbon and Sulfur Cycling:

    • S. pomeroyi employs a lithoheterotrophic strategy using inorganic compounds (carbon monoxide and sulfide) to supplement heterotrophy

    • Cobalamin-dependent enzymes are often involved in carbon and sulfur metabolism

    • CobD function ultimately enables cobalamin-dependent processes central to these biogeochemical cycles

  • Ecological Adaptations:

    • The specialized CobD in Rhodobacterales represents an evolutionary adaptation to marine environments

    • This adaptation likely contributes to the ecological success of Roseobacters, which constitute 10-20% of coastal and oceanic mixed-layer bacterioplankton

    • Understanding CobD helps explain how these bacteria thrive in nutrient-poor oceans

  • Marine Bacterial Interactions:

    • Cobalamin production by bacteria like S. pomeroyi creates dependencies and symbiotic relationships with other marine organisms

    • The efficiency of pathways containing CobD influences these cross-feeding relationships

    • Understanding this pathway helps explain complex trophic interactions in marine microbial communities

By studying S. pomeroyi CobD, researchers gain insights into the molecular mechanisms underpinning these broader ecological and biogeochemical processes, adding to our understanding of marine ecosystem functioning and potential responses to environmental changes .

How can site-directed mutagenesis of S. pomeroyi CobD be designed to investigate structure-function relationships?

A systematic approach to site-directed mutagenesis of S. pomeroyi CobD could include:

  • Target Selection Based on Sequence Conservation:

    • Identify highly conserved residues across CobD homologs

    • Focus on predicted catalytic residues, substrate binding sites, and structural elements

    • Prioritize unique residues that differentiate S. pomeroyi CobD from non-marine homologs

  • Mutation Design Strategy:

    • Conservative mutations (e.g., Asp→Glu) to probe subtle functional changes

    • Non-conservative mutations (e.g., Asp→Ala) to abolish specific interactions

    • Introduction of cysteine residues for subsequent chemical modification or cross-linking studies

  • Experimental Workflow:

    • Create mutations using standard PCR-based methods or commercial site-directed mutagenesis kits

    • Express and purify mutant proteins using the established His-tag purification protocol

    • Compare enzyme kinetics, thermal stability, and substrate specificity between wild-type and mutant proteins

  • Specific Residues to Target:

    • Predicted PLP-binding lysine residue(s)

    • Residues in the predicted active site pocket

    • Residues at subunit interfaces if oligomerization is required for activity

    • Potential membrane-interacting regions in the N-terminal domain

  • Analysis Methods:

    • Enzymatic activity assays with varying substrates

    • Thermal stability measurements using differential scanning fluorimetry

    • Structural analysis by circular dichroism to detect conformational changes

    • Binding studies with isothermal titration calorimetry

This approach would provide valuable insights into the catalytic mechanism and structural requirements of S. pomeroyi CobD, potentially revealing adaptations specific to its function in marine environments.

What approaches can be used to investigate potential protein-protein interactions between CobD and other cobalamin biosynthesis enzymes in S. pomeroyi?

Several complementary approaches can be employed to investigate protein-protein interactions between CobD and other cobalamin biosynthesis enzymes:

  • Co-immunoprecipitation (Co-IP):

    • Generate antibodies against S. pomeroyi CobD or use anti-His antibodies for the recombinant protein

    • Prepare cell lysates from S. pomeroyi or heterologous expression systems

    • Perform pull-down experiments to identify interacting partners

    • Analyze by mass spectrometry to identify co-precipitated proteins

  • Bacterial Two-Hybrid (B2H) or Yeast Two-Hybrid (Y2H) Systems:

    • Create fusion constructs of CobD and potential partners (e.g., BluE, CobC/BluD)

    • Screen for positive interactions in reporter systems

    • Validate with deletion constructs to map interaction domains

  • In vitro Reconstitution:

    • Express and purify multiple components of the pathway

    • Perform binding studies using surface plasmon resonance or isothermal titration calorimetry

    • Analyze complex formation by size-exclusion chromatography

  • Cross-linking Studies:

    • Use chemical cross-linkers with purified proteins or in vivo

    • Identify cross-linked complexes by mass spectrometry

    • Map interaction interfaces from cross-linked peptides

  • Fluorescence-based Methods:

    • Fluorescence resonance energy transfer (FRET) with fluorescently labeled proteins

    • Bimolecular fluorescence complementation (BiFC) in vivo

    • Fluorescence correlation spectroscopy for real-time interaction dynamics

  • Structural Biology Approaches:

    • Attempt co-crystallization of CobD with interacting partners

    • Use cryo-EM to visualize larger complexes

    • NMR studies for mapping interaction surfaces

Since the cobalamin biosynthetic pathway in Rhodobacterales has unique features , investigating these interactions could reveal novel regulatory mechanisms and pathway organization specific to marine bacteria. Particular attention should be paid to potential interactions between CobD and BluE, as these enzymes catalyze sequential steps in the nucleotide loop formation pathway .

How could thermal stability engineering be applied to improve the utility of recombinant S. pomeroyi CobD for biotechnological applications?

Engineering the thermal stability of recombinant S. pomeroyi CobD could significantly enhance its utility for biotechnology applications using the following approaches:

  • Rational Design Based on Comparative Analysis:

    • Identify thermostable homologs of CobD from extremophilic organisms

    • Perform multiple sequence alignments to identify stabilizing residues

    • Introduce these stabilizing mutations into S. pomeroyi CobD

    • A similar approach proved successful for enhancing thermostability of another S. pomeroyi enzyme (amine transaminase) as described in source

  • Directed Evolution:

    • Create random mutagenesis libraries of the cobD gene

    • Screen/select for variants with enhanced thermal stability

    • Combine beneficial mutations through DNA shuffling

    • Iterate for multiple generations to achieve desired stability

  • Computational Design:

    • Use protein modeling software to predict stabilizing mutations

    • Focus on introducing additional salt bridges, hydrogen bonds, or disulfide bonds

    • Reduce surface hydrophobicity or increase core packing

    • Implement rigidifying mutations in flexible regions

  • Ancestral Sequence Reconstruction:

    • Infer ancestral sequences of CobD proteins

    • Express and test these reconstructed proteins for enhanced stability

    • This approach has shown promising results for other S. pomeroyi enzymes as demonstrated in source

  • Stability Assessment Methods:

    • Differential scanning fluorimetry to measure melting temperature (Tm)

    • Monitoring half-life at elevated temperatures

    • Circular dichroism to assess secondary structure retention during thermal denaturation

    • Activity measurements after heat treatment

  • Formulation Approaches:

    • Identify stabilizing buffer components and additives

    • Test the effect of osmolytes and kosmotropic salts

    • Investigate enzyme immobilization on various supports

For S. pomeroyi CobD specifically, engineering efforts should consider the balance between stability and activity, as marine enzymes may have evolved for function at lower temperatures compared to industrial conditions. The successful thermostabilization of another S. pomeroyi enzyme described in source provides a promising precedent for this approach.

What considerations are important for optimizing heterologous expression of S. pomeroyi CobD to maximize yield and activity?

Optimizing heterologous expression of S. pomeroyi CobD requires careful consideration of multiple factors:

  • Expression System Selection:

    • E. coli is the most common host for S. pomeroyi protein expression

    • Consider BL21(DE3) or derivatives optimized for membrane-associated proteins

    • Alternative hosts (Pseudomonas, Rhodobacter) may provide better folding environment for this marine bacterial protein

  • Codon Optimization:

    • Analyze codon usage bias between S. pomeroyi and expression host

    • Optimize rare codons, particularly in high-expression regions

    • Balance GC content for improved mRNA stability

  • Vector Design:

    • Select appropriate promoter strength (T7, tac, ara)

    • Include solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Incorporate cleavable tags for tag removal if needed

    • Consider periplasmic targeting for improved folding

  • Expression Conditions:

    • Test multiple induction temperatures (15-30°C)

    • Optimize inducer concentration (typically IPTG for T7 systems)

    • Evaluate different media formulations (LB, TB, auto-induction)

    • Consider extended expression times at lower temperatures

  • Cofactor Supplementation:

    • Add pyridoxal-5'-phosphate (PLP) to growth media if needed

    • Supplement with other potential cofactors based on enzyme requirements

  • Solubility Enhancement:

    • Test co-expression with chaperones (GroEL/ES, DnaK/J)

    • Evaluate additives in lysis buffer (glycerol, mild detergents)

    • Consider fusion to solubility-enhancing tags

  • Purification Optimization:

    • Fine-tune buffer composition for maximum stability

    • Optimize imidazole concentrations for His-tag purification

    • Consider additional purification steps (ion exchange, size exclusion)

    • Include stabilizing agents (glycerol, reducing agents) in storage buffer

  • Activity Preservation:

    • Determine optimal storage conditions (-20°C or -80°C in 50% glycerol)

    • Avoid repeated freeze-thaw cycles

    • Aliquot protein for single-use to maintain activity

    • Test protease inhibitors if degradation is observed

By systematically optimizing these parameters, researchers can maximize both yield and activity of recombinant S. pomeroyi CobD, facilitating further structural and functional studies of this important enzyme.

How might recombinant S. pomeroyi CobD be used to develop biosensors for vitamin B12 pathway intermediates?

Recombinant S. pomeroyi CobD could be engineered into biosensors for vitamin B12 pathway intermediates through several innovative approaches:

  • Enzyme-Coupled Spectrophotometric Sensors:

    • Link CobD activity to NAD(P)H-dependent reactions for fluorescence readout

    • Design coupled assays where CobD substrate/product levels affect a reporter enzyme

    • Develop continuous monitoring systems for L-Thr-P or EA-P in biological samples

  • FRET-Based Biosensors:

    • Engineer CobD with fluorescent protein pairs (e.g., CFP/YFP) that undergo conformational changes upon substrate binding

    • Monitor FRET signal changes as a direct measure of substrate interaction

    • Optimize sensor dynamic range through rational protein engineering

  • Electrochemical Biosensors:

    • Immobilize CobD on electrode surfaces

    • Couple enzyme activity to electron transfer reactions

    • Develop amperometric or potentiometric detection systems for pathway intermediates

  • Whole-Cell Biosensors:

    • Create reporter strains where CobD substrate/product levels control expression of fluorescent proteins or luciferases

    • Design genetic circuits linking CobD activity to easily measurable outputs

    • Optimize for sensitivity and specificity to particular pathway intermediates

  • Surface Plasmon Resonance (SPR) Applications:

    • Immobilize CobD on SPR chips

    • Detect substrate binding through refractive index changes

    • Develop high-throughput screening platforms for pathway analysis

  • Aptamer-Enzyme Hybrid Sensors:

    • Combine CobD with aptamers that bind specific pathway intermediates

    • Design systems where substrate binding modulates enzyme activity

    • Create multiplexed detection platforms for multiple intermediates

  • Point-of-Care Diagnostic Applications:

    • Integrate CobD-based sensing elements into microfluidic devices

    • Develop paper-based assays for field detection of pathway intermediates

    • Create smartphone-compatible readout systems for quantitative analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.