Recombinant Silicibacter pomeroyi Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to Silicibacter pomeroyi and Its Enzymatic Profile

Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) is a marine bacterium belonging to the Rhodobacteraceae family. Originally classified as Silicibacter pomeroyi, it is sometimes referenced as Ruegeria pomeroyi in more recent literature, reflecting taxonomic reclassification of this organism. This bacterium has been extensively studied as a model organism for understanding various metabolic pathways, particularly those involved in marine ecological processes .

S. pomeroyi is notable for its metabolic versatility, including its ability to process dimethylsulfoniopropionate (DMSP) through both cleavage and demethylation pathways . This organism possesses multiple enzyme systems that enable it to adapt to varying environmental conditions, including the presence of oxidative stress. Among its enzymatic repertoire, the Glycerol-3-phosphate acyltransferase (plsY) plays a crucial role in membrane phospholipid biosynthesis.

Protein Identity and Classification

Glycerol-3-phosphate acyltransferase (plsY) from S. pomeroyi is classified as a transferase enzyme (EC 2.3.1.n3) that catalyzes the transfer of an acyl group to a glycerol-3-phosphate molecule . This represents a critical step in bacterial phospholipid biosynthesis. The enzyme is also known by several alternative names:

  • Acyl-PO4 G3P acyltransferase

  • Acyl-phosphate--glycerol-3-phosphate acyltransferase

  • G3P acyltransferase (GPAT)

The gene encoding this enzyme is designated as plsY (gene name) with the ordered locus name SPO0283 in the S. pomeroyi genome .

Catalytic Mechanism

As a glycerol-3-phosphate acyltransferase, plsY catalyzes the first step in phospholipid biosynthesis through the acylation of the sn-1 position of glycerol-3-phosphate. This reaction represents a critical junction in the formation of phosphatidic acid, a precursor for all glycerophospholipids in bacterial membranes.

The general reaction catalyzed by plsY can be represented as:

Acyl-phosphate + Glycerol-3-phosphate → Lysophosphatidic acid + Inorganic phosphate

This enzymatic activity is fundamental to bacterial cell membrane formation, as phospholipids constitute the primary structural components of cellular membranes.

Recombinant Expression Systems

The recombinant form of S. pomeroyi plsY refers to the protein produced through genetic engineering techniques in which the plsY gene has been inserted into an expression vector and produced in a heterologous host system. This approach allows for controlled production of the enzyme for research and potential biotechnological applications.

Enzyme Kinetics Studies

Recombinant enzymes like S. pomeroyi plsY can be used in enzyme kinetics studies to determine parameters such as Km and Vmax values, providing insights into the efficiency and substrate affinity of the enzyme3. Such studies typically involve measuring reaction rates at different substrate concentrations under controlled conditions.

Biotechnological Applications

Acyltransferases have potential applications in biotechnology, including:

  1. Biocatalysis for the synthesis of specialty lipids

  2. Development of biosensors for detecting lipid precursors

  3. Engineering of microbial strains for enhanced lipid production

While specific applications of S. pomeroyi plsY have not been extensively documented, research on related enzymes from other organisms suggests potential utility in these areas.

Comparative Analysis with Other Bacterial Enzymes

Enzymatic systems for phospholipid biosynthesis exist across bacterial species, with variations in substrate specificity and regulatory mechanisms. The study of S. pomeroyi plsY can be contextualized within the broader understanding of bacterial membrane biogenesis.

Research on enzymes from Silicibacter pomeroyi has shown that protein engineering approaches can be employed to enhance properties such as thermostability, as demonstrated with other enzymes from this organism . While specific studies on plsY thermostability enhancement are not documented in the provided search results, similar approaches could potentially be applied to this enzyme.

Future Research Directions

Several promising research directions for S. pomeroyi plsY include:

  1. Investigation of the enzyme's role in bacterial adaptation to marine environments

  2. Structure-function studies to elucidate the molecular basis of catalysis

  3. Exploration of potential inhibitors as antimicrobial agents

  4. Engineering efforts to modify substrate specificity or enhance stability

  5. Integration of plsY function within broader metabolic models of S. pomeroyi

These research avenues could contribute to both fundamental understanding of bacterial membrane biology and potential biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchasing method or location. We recommend contacting your local distributor for specific delivery estimates.
Note: All protein shipments include standard blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
plsY; SPO0283; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi)
Target Names
plsY
Target Protein Sequence
MPAFDTPAMMLILWAVIGYGLGSIPFGLILTRAMGMGDLRQIGSGNIGTTNVLRTGNKGA AALTLLLDGGKGAVAVLLARAFAGEDAAQVAALAAFVGHCYPIWLGFKGGKGVATFLGLW LALAWPVGVACCLSWLAGAAVTRISSMGALVAAASSTFWLVLLDQGAGFVLGIVLTLMVF WRHRANIARLKARTEPKIGQKSA
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While utilizing acyl-phosphate as the fatty acyl donor, it does not utilize acyl-CoA or acyl-ACP.
Database Links

KEGG: sil:SPO0283

STRING: 246200.SPO0283

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in bacterial membrane biosynthesis?

Glycerol-3-phosphate acyltransferase (plsY) plays a crucial role in bacterial membrane phospholipid biosynthesis by catalyzing the transfer of acyl groups from acylphosphate to glycerol 3-phosphate. This reaction represents a key step in the most widely distributed biosynthetic pathway for initiating phosphatidic acid formation in bacterial membranes. The pathway involves the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the transfer of the acyl group to glycerol 3-phosphate by PlsY, an integral membrane protein . This enzymatic activity is essential for bacterial cell membrane development and integrity, making it a significant target for understanding bacterial physiology and potential antimicrobial development.

How is Silicibacter pomeroyi plsY classified enzymatically?

Silicibacter pomeroyi Glycerol-3-phosphate acyltransferase (plsY) is classified under the Enzyme Commission (EC) number 2.3.1.n3, which places it in the transferase family that forms ester bonds . The enzyme is specifically known as Acyl-phosphate--glycerol-3-phosphate acyltransferase or G3P acyltransferase (GPAT) . Its gene designation is plsY with the ordered locus name SPO0283 in the S. pomeroyi genome . The enzyme belongs to the broader family of acyltransferases that catalyze the transfer of acyl groups to various acceptors, which is critical for phospholipid biosynthesis in bacterial systems.

What are the optimal storage conditions for recombinant Silicibacter pomeroyi plsY to maintain enzymatic activity?

For optimal preservation of enzymatic activity, recombinant Silicibacter pomeroyi plsY should be stored at -20°C in the short term, while -80°C is recommended for extended storage periods . The protein is typically maintained in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein to maintain stability and prevent denaturation . For ongoing experiments, working aliquots can be stored at 4°C but should not be kept for more than one week to prevent activity loss. It is critical to avoid repeated freeze-thaw cycles as this significantly compromises protein integrity and catalytic function . When designing experiments with this enzyme, researchers should prepare appropriately sized aliquots to minimize the need for multiple freeze-thaw events.

What methods are effective for determining the membrane topology of plsY proteins?

The substituted cysteine accessibility method (SCAM) has proven effective for determining the membrane topology of plsY proteins, as demonstrated with Streptococcus pneumoniae PlsY . This methodology involves systematically replacing amino acids with cysteine residues at various positions throughout the protein sequence, followed by assessing the accessibility of these cysteines to membrane-impermeable sulfhydryl reagents. The results from such experiments with S. pneumoniae PlsY revealed a structure with five membrane-spanning segments, with the amino terminus and two short loops located on the external face of the membrane .

For Silicibacter pomeroyi plsY research, adapting this methodology would involve:

  • Generating a series of cysteine substitution mutants throughout the S. pomeroyi plsY sequence

  • Expressing these mutants in an appropriate bacterial expression system

  • Treating intact cells or membrane preparations with membrane-impermeable sulfhydryl-reactive reagents

  • Analyzing the labeling patterns to determine which regions are accessible from which side of the membrane

  • Constructing a topological model based on the experimental data

This approach can be complemented with computational prediction tools that analyze hydrophobicity patterns and other sequence features that indicate transmembrane regions.

What expression systems are most suitable for producing active recombinant Silicibacter pomeroyi plsY?

Based on the characteristics of Silicibacter pomeroyi plsY and similar membrane proteins, the following expression systems are recommended:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coli BL21(DE3)High yield, simple manipulation, cost-effectivePotential inclusion body formation, toxicityLower induction temperature (16-20°C), use of specialized vectors with tight expression control
E. coli C41/C43Designed for membrane protein expression, reduces toxicityLower yields than standard BL21Optimize induction conditions, use mild detergents for extraction
Bacillus subtilisGram-positive system, potential for better foldingLess established tools than E. coliOptimize codon usage, use strong promoters with controlled expression
Cell-free systemsAvoids toxicity issues, direct incorporation into liposomesHigher cost, lower scalabilitySupplement with lipids or detergents to support membrane protein folding

For optimal results, expression in E. coli C41/C43 strains at lower temperatures (16-20°C) with mild induction conditions is often the starting point when working with bacterial membrane proteins like plsY. The expressed protein should be extracted using gentle detergents that maintain the native conformation and enzymatic activity.

What are the critical conserved motifs in plsY proteins and their roles in catalysis?

Based on research on bacterial plsY proteins, three conserved sequence motifs have been identified in cytoplasmic domains that are critical for catalytic function:

MotifKey ResiduesFunctional RoleEffect of Mutations
Motif 1Serine, ArginineEssential for catalytic activity, likely involved in substrate recognition or positioningLoss of enzyme activity
Motif 2Conserved GlycinesCharacteristic phosphate-binding loop, corresponds to the glycerol 3-phosphate binding siteMutations to alanines result in increased Km for glycerol 3-phosphate, indicating reduced binding affinity
Motif 3Histidine, Asparagine, GlutamateHistidine and Asparagine important for activity; Glutamate critical for structural integrityAlterations affect both catalytic efficiency and protein stability

Site-directed mutagenesis studies have confirmed that each of these conserved domains is critical for plsY catalysis . While these findings are based on studies of S. pneumoniae PlsY, the high conservation of these motifs across bacterial species suggests that Silicibacter pomeroyi plsY likely shares similar critical functional elements. Understanding these motifs provides valuable insights for structure-function studies and potential inhibitor design targeting specific catalytic residues.

What enzymatic assays are most reliable for measuring plsY activity and kinetics?

Several enzymatic assays can be employed for reliable measurement of plsY activity and kinetics:

Assay TypeMethodologyAdvantagesLimitationsData Analysis Approach
Radiochemical AssayUsing [14C]- or [3H]-labeled acylphosphate or glycerol 3-phosphate substrates and measuring labeled product formationHigh sensitivity, direct quantification of product formationRequires radioisotope handling facilities, specialized disposalMichaelis-Menten kinetic analysis of initial rates at varying substrate concentrations
Coupled Enzyme AssayLinking plsY activity to consumption or production of NAD(P)H through auxiliary enzymesContinuous monitoring, adaptable to high-throughput formatPotential interference from coupling enzymes, requires optimizationReal-time kinetic measurements with appropriate controls for coupling enzyme activity
LC-MS Based AssayDirect detection and quantification of reaction products via liquid chromatography-mass spectrometryHigh specificity, can detect multiple products simultaneouslyRequires specialized equipment, lower throughputIntegration of product peaks relative to internal standards
Colorimetric Phosphate Release AssayMonitoring release of inorganic phosphate during reactionSimple setup, widely accessibleIndirect measurement, potential background interferenceStandard curve for phosphate quantification, multiple time-point sampling

For optimal results with S. pomeroyi plsY, a radiochemical assay using [14C]-labeled substrates is often preferred for detailed kinetic characterization, while a coupled enzyme system might be more suitable for inhibitor screening or high-throughput applications. When analyzing inhibition patterns, such as the noncompetitive inhibition observed with palmitoyl-CoA in other plsY proteins , appropriate kinetic models should be applied to determine inhibition constants accurately.

What strategies can be employed to overcome challenges in expressing and purifying active Silicibacter pomeroyi plsY?

As an integral membrane protein, Silicibacter pomeroyi plsY presents several challenges for expression and purification. The following comprehensive strategies can help overcome these difficulties:

  • Expression Optimization:

    • Test multiple expression hosts (E. coli C41/C43, Bacillus species, cell-free systems)

    • Employ fusion tags that enhance solubility (MBP, SUMO) while enabling affinity purification

    • Optimize expression temperature (typically 16-20°C) and induction conditions (reduced IPTG concentration, longer expression time)

    • Consider codon optimization for the expression host

    • Engineer constructs with truncated N- or C-termini if full-length expression is problematic

  • Membrane Extraction:

    • Screen various detergents for optimal extraction (DDM, LDAO, FC-12)

    • Employ gentle solubilization conditions (4°C, longer extraction time)

    • Consider detergent mixtures or lipid-detergent micelles to maintain native-like environment

    • Test nanodiscs or amphipols for stabilizing the purified protein

  • Purification Strategy:

    • Implement multi-step purification (affinity chromatography followed by size exclusion)

    • Maintain detergent concentration above critical micelle concentration throughout purification

    • Include glycerol (10-15%) in all buffers to enhance stability

    • Consider on-column detergent exchange to identify optimal stabilizing conditions

    • Validate protein activity at each purification stage to ensure functionality is preserved

  • Quality Assessment:

    • Employ analytical SEC to assess protein monodispersity

    • Verify proper folding using circular dichroism spectroscopy

    • Confirm activity using established enzymatic assays before proceeding to structural or functional studies

These approaches should be systematically evaluated to establish an optimized protocol for obtaining active S. pomeroyi plsY suitable for detailed biochemical and structural characterization.

How can site-directed mutagenesis be effectively applied to study structure-function relationships in Silicibacter pomeroyi plsY?

Site-directed mutagenesis represents a powerful approach for elucidating structure-function relationships in Silicibacter pomeroyi plsY. Based on studies of related plsY proteins, the following strategic mutagenesis approach is recommended:

  • Target Selection Based on Conserved Motifs:

    • Motif 1: Generate serine and arginine mutants (to alanine) to assess their roles in catalysis

    • Motif 2: Create glycine to alanine mutations to evaluate their importance in glycerol 3-phosphate binding

    • Motif 3: Develop histidine, asparagine, and glutamate mutations to determine their contributions to activity and structural integrity

  • Systematic Experimental Approach:

    • Generate single-point mutations initially, followed by double mutations to assess synergistic effects

    • Express mutant proteins under identical conditions as wild-type

    • Analyze expression levels, membrane integration, and protein stability before enzyme activity assessment

    • Perform detailed kinetic analysis comparing Km and kcat values of mutants with wild-type enzyme

  • Structure-Function Correlation:

    • Map mutations onto predicted structural models of S. pomeroyi plsY

    • Correlate functional effects with structural location to develop a comprehensive mechanistic model

    • Consider conservative mutations (e.g., serine to threonine) to distinguish between structural and catalytic roles

  • Advanced Analysis:

    • Perform substrate specificity assays with mutants to identify residues involved in acyl chain recognition

    • Test temperature and pH stability of critical mutants to assess their role in maintaining protein conformation

    • Consider combining mutagenesis with chemical modification studies to probe accessibility of key residues

This systematic mutagenesis approach, coupled with detailed biochemical characterization, will provide valuable insights into the catalytic mechanism and structural determinants of S. pomeroyi plsY function.

What computational approaches can be used to predict substrate specificity and inhibitor binding to Silicibacter pomeroyi plsY?

Advanced computational methods offer powerful tools for predicting substrate specificity and potential inhibitor interactions with Silicibacter pomeroyi plsY:

  • Homology Modeling and Molecular Dynamics:

    • Develop homology models based on structurally characterized bacterial acyltransferases

    • Refine models through extensive molecular dynamics simulations in explicit membrane environments

    • Analyze conformational dynamics to identify potential substrate binding sites and catalytic residues

    • Validate models through comparison with experimental mutagenesis data

  • Substrate Docking and Binding Analysis:

    • Perform docking studies with various acylphosphate and glycerol 3-phosphate substrates

    • Calculate binding energies to predict substrate preferences

    • Analyze specific protein-substrate interactions to identify determinants of specificity

    • Use QM/MM approaches to model the reaction mechanism and transition states

  • Virtual Screening for Potential Inhibitors:

    • Develop pharmacophore models based on substrate binding patterns

    • Screen virtual compound libraries against identified binding sites

    • Prioritize compounds based on predicted binding affinity and interactions with catalytic residues

    • Consider fragment-based approaches to identify novel chemical scaffolds

  • Machine Learning Applications:

    • Train predictive models using known substrate/inhibitor data from related acyltransferases

    • Apply trained models to predict activity against novel substrates or inhibitors

    • Incorporate evolutionary conservation data to enhance prediction accuracy

    • Use deep learning approaches to identify non-obvious patterns in substrate recognition

These computational strategies, when integrated with experimental validation, can significantly accelerate the understanding of S. pomeroyi plsY substrate specificity and facilitate the rational design of selective inhibitors for research or potential antimicrobial applications.

How does Silicibacter pomeroyi plsY compare functionally to plsY proteins from other bacterial species?

Comparative analysis reveals both conserved features and notable differences between Silicibacter pomeroyi plsY and its counterparts in other bacterial species:

Understanding these comparative aspects provides valuable insights into both the fundamental conservation of phospholipid biosynthesis across bacterial phylogeny and the specific adaptations that may have evolved in different ecological niches.

What role does plsY play in the adaptation of Silicibacter pomeroyi to its marine environment?

As a marine alpha-proteobacterium, Silicibacter pomeroyi has adapted to unique environmental challenges, with plsY potentially playing key roles in these adaptations:

  • Membrane Composition Adaptation:
    Marine bacteria often require specialized membrane compositions to manage osmotic stress, temperature fluctuations, and hydrostatic pressure. The plsY enzyme likely contributes to these adaptations by incorporating specific acyl chains that optimize membrane fluidity and stability under marine conditions. The specificity of S. pomeroyi plsY may be tuned to preferentially utilize acyl chains that are abundant in its marine environment.

  • Metabolic Integration:
    S. pomeroyi is known for its metabolic versatility in utilizing diverse carbon sources available in marine environments. The plsY enzyme would need to functionally integrate with these metabolic networks, potentially utilizing acyl-ACP or acyl-phosphate donors derived from various carbon substrates unique to marine ecosystems.

  • Temperature and Pressure Responses:
    Marine environments feature temperature gradients and pressure variations that affect membrane integrity. S. pomeroyi plsY likely possesses structural features that maintain catalytic efficiency across these environmental variables, potentially including greater conformational flexibility or specific stabilizing interactions not present in terrestrial bacterial homologs.

  • Interaction with Marine Microbiome:
    In the context of marine microbial communities, S. pomeroyi engages in complex interactions with other organisms. The specific activity of plsY could influence membrane properties that affect cell-cell interactions, biofilm formation, or resistance to compounds produced by competing microorganisms.

Understanding these adaptive roles of plsY provides insights not only into S. pomeroyi physiology but also into broader principles of bacterial adaptation to specialized ecological niches.

What research approaches can elucidate the evolutionary history and diversification of plsY across bacterial phyla?

Several sophisticated research approaches can illuminate the evolutionary trajectory and functional diversification of plsY across bacterial lineages:

  • Comprehensive Phylogenomic Analysis:

    • Construct maximum-likelihood phylogenetic trees using plsY sequences from diverse bacterial phyla

    • Implement codon-based models to detect signatures of selection (dN/dS ratios)

    • Apply ancestral sequence reconstruction to infer the properties of ancient plsY enzymes

    • Correlate plsY phylogeny with bacterial taxonomy to identify horizontal gene transfer events

  • Structure-Based Evolutionary Analysis:

    • Map sequence conservation onto structural models to identify evolutionarily constrained regions

    • Analyze co-evolving residue networks to identify functionally linked amino acid positions

    • Compare predicted binding sites across diverse bacterial plsY proteins to track substrate specificity evolution

    • Identify lineage-specific structural adaptations that correlate with environmental niches

  • Experimental Evolutionary Biochemistry:

    • Express and characterize plsY orthologs from key phylogenetic branch points

    • Test substrate preferences across diverse bacterial plsY representatives

    • Engineer chimeric enzymes combining domains from different bacterial phyla to assess functional modularity

    • Recreate predicted ancestral plsY sequences to test their biochemical properties

  • Genomic Context Analysis:

    • Analyze conservation of genetic neighborhoods around plsY across bacterial genomes

    • Identify co-evolving partner proteins in phospholipid biosynthesis pathways

    • Examine regulatory elements across diverse bacteria to understand expression evolution

    • Correlate plsY variants with lipid compositions across bacterial species

This multi-faceted approach would provide a comprehensive understanding of how plsY has evolved and diversified across bacterial lineages, illuminating both conserved catalytic mechanisms and adaptive variations that have emerged in response to diverse ecological pressures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.