Recombinant Silicibacter pomeroyi Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Critical Residues and Motifs

  • TM3 and TM5: Hydrophobic residues stabilize substrate insertion into the lipid bilayer .

  • Cytoplasmic HPD: Interacts with ribosomal exit sites and nascent polypeptides .

  • Periplasmic Domains: May coordinate with SecYEG in holotranslocon complexes .

Functional Mechanism in Membrane Protein Insertion

YidC operates through two primary pathways:

  1. Sec-independent insertion: Directly integrates small substrates (e.g., Pf3 coat protein) via electrostatic interactions between the YidC hydrophilic groove and substrate termini .

  2. Sec-dependent assistance: Collaborates with SecYEG to fold Sec-translocated proteins (e.g., LacY) into functional conformations .

Key Steps in YidC-Mediated Insertion

  1. Ribosome Binding: YidC interacts with the ribosomal tunnel exit via the HPD .

  2. Substrate Recruitment: Negative charges on substrates (e.g., D7 in Pf3) form salt bridges with positively charged YidC residues (e.g., R72) .

  3. Membrane Thinning: YidC induces lipid bilayer thinning (~7–10 Å) to reduce energetic barriers for hydrophilic domain translocation .

  4. Substrate Release: Hydrophobic TM segments partition into the lipid core, displacing polar regions .

pomeroyi YidC in Biotechnology

  • Protein Production: Recombinant S. pomeroyi YidC is purified for structural studies or functional assays (e.g., ELISA kits for antibody validation) .

  • Mechanistic Studies: Limited data exist on S. pomeroyi YidC’s unique adaptations compared to E. coli homologs.

Challenges in Studying Marine Bacterial YidC

  • Low Sequence Homology: S. pomeroyi YidC shares ~30% identity with E. coli YidC, suggesting divergent functional adaptations .

  • Experimental Limitations: No published studies directly assess S. pomeroyi YidC’s activity or substrate specificity.

Comparative Analysis with Homologs

FeatureS. pomeroyi YidC E. coli YidC
TM Domains5 (TM1–TM5)5 (TM1–TM5)
HPDCytoplasmic helical hairpinCytoplasmic helical hairpin
Sec InteractionNot characterizedCrosslinks with SecY (TM3/TM8)
Substrate PreferenceUnknownPf3, MscL, LacY

Future Directions

  1. Structural Studies: Cryo-EM or X-ray crystallography to resolve S. pomeroyi YidC’s conformational dynamics.

  2. Functional Assays: In vitro reconstitution of YidC-dependent insertion for marine-specific substrates.

  3. Ecological Relevance: Role of YidC in S. pomeroyi’s adaptation to marine environments (e.g., CO/sulfide metabolism) .

References

  1. Wickles et al. (2014) – Structural model of E. coli YidC .

  2. Dalbey et al. (2019) – YidC’s conserved role in membrane biogenesis .

  3. Kedrov et al. (2009) – YidC-Oxa1 dimerization and ribosome binding .

  4. Kiefer et al. (2021) – YidC-SecY interaction in proteoliposomes .

  5. Frontiers study (2022) – Pf3 insertion mechanism via YidC .

  6. Moran et al. (2004) – S. pomeroyi genome sequence .

  7. CBM15 product page – Recombinant S. pomeroyi YidC specs .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
yidC; SPO0532; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-609
Protein Length
full length protein
Species
Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi)
Target Names
yidC
Target Protein Sequence
MDDQNKNLILATALSFLVILVWFILFPPPEQTEAPATEIATTNGTAVQTPTAAATEGGAG EVPALDSAAPTQAEAPRVQIDTPRLKGSVSLLGGRIDELSLKDYRVSLDEDAEIVEMLTP AGSTSAYYALYGWAPGAGLNAADVPGPLTEWSLESGDTLSVGTPVTLSWSNGSGVTFRRT LAVDEDYMFTVTQSVENGSAAPIGAAPYGILARHGIGEDADLPGLKNFFILHEGVVAMND GTLSEIDYKDVRKFDIDPNEGAQAEVFQNKSDGWIGFTDHYWMATLIPGSGTAFKSAAKY DARRKIYQAETVLPTMSVAPGESAEVTTRLFAGAKEWESIRAYQQDGVQKFLDSIDWGWF FFLTKPIFWLLHQINGLIGNMGWSIIGLTLIIKAIVFPLALKSYVSMAKMKELQPQMEAL KEAAGDDRQKMQQGMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRQAPWFG PFRDLSMPDPTSIMNFFGWLPWAGPEAGSLTATILIGILPLLLGISMWLQQKLNPAPTDP TQAMIFAWMPWVFMFMLGSFASGLVVYWIANNTITFTQQYIIMRSHGYKPDVFGNIKSGF ARRAKADKK
Uniprot No.

Target Background

Function
YidC is essential for the insertion and proper folding of integral membrane proteins into the membrane. It plays a crucial role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as in the insertion of at least some lipoproteins. YidC also assists in the folding of multispanning membrane proteins.
Database Links

KEGG: sil:SPO0532

STRING: 246200.SPO0532

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its function in bacterial systems?

YidC is a membrane protein insertase that catalyzes the insertion of proteins into the prokaryotic plasma membrane. Unlike the Sec translocase, which functions as a transmembrane channel that opens laterally to bind and release hydrophobic segments of substrate proteins into the lipid bilayer, YidC insertases interact with their substrates through a groove-like structure at an amphiphilic protein-lipid interface. This unique mechanism allows transmembrane segments of substrate proteins to slide directly into the lipid bilayer . In bacteria like Silicibacter pomeroyi, YidC likely plays a critical role in membrane protein biogenesis, similar to its function in other prokaryotes.

How is YidC conserved across different species including Silicibacter pomeroyi?

YidC is widely conserved across multiple domains of life, with homologs found in bacteria, archaea, mitochondria, and chloroplasts . This conservation indicates the fundamental importance of this protein insertion mechanism. While Silicibacter pomeroyi's genome (4,109,442 base pairs in the chromosome plus a 491,611 base pair megaplasmid) has been sequenced , specific conservation patterns of its YidC would need to be analyzed through comparative genomics approaches. Given S. pomeroyi's importance as a representative of the marine Roseobacter clade (comprising approximately 10-20% of coastal and oceanic mixed-layer bacterioplankton), understanding its YidC could provide insights into membrane protein biogenesis in environmentally significant marine bacteria .

What is known about YidC substrates in bacteria?

YidC is known to be involved in the biogenesis of a diverse range of membrane proteins that participate in various cellular processes including macromolecule transport, signal transduction, respiration, and electron transport . Studies have identified specific YidC substrates such as FtsEX and FtsQ, which are involved in cell septation and cytokinesis . The substrate profile of YidC in marine bacteria like Silicibacter pomeroyi may include proteins involved in its unique lithoheterotrophic strategy, which enables this organism to supplement heterotrophy with inorganic compounds like carbon monoxide and sulfide .

What expression systems are recommended for producing recombinant S. pomeroyi YidC?

Based on successful approaches with other bacterial YidC proteins, expression of recombinant S. pomeroyi YidC would likely involve:

  • Vector selection: Vectors similar to pBAD24 or pP-tac systems used successfully for other YidC variants

  • Expression host: E. coli strains optimized for membrane protein production

  • Purification approach: His-tag purification techniques similar to those used for other recombinant YidC proteins

  • Expression conditions: Controlled induction with arabinose or IPTG at concentrations around 0.2% and 100 μM respectively, based on protocols used for other YidC studies

When designing your expression construct, consider excluding the non-conserved first transmembrane helix (TM1) and P1 domain to focus on the conserved core, as this approach has been successful in structural studies of YidC .

What assays can be used to measure YidC activity in vitro?

Several methodological approaches can be employed to assess YidC activity:

  • In vivo complementation assays: Testing the ability of S. pomeroyi YidC variants to complement YidC-depleted E. coli

  • Site-directed mutagenesis: Creating alanine mutants of potentially critical residues identified through structural analysis and testing their activity in complementation assays

  • Crosslinking studies: Identifying interactions between YidC and its substrates or other components of the insertion machinery

  • Membrane protein insertion assays: Tracking the insertion efficiency of model substrates in proteoliposomes containing purified YidC

The effectiveness of these methods can be validated through protein expression verification using western blotting to ensure stable expression of the YidC variants being studied .

How can the structure of S. pomeroyi YidC be predicted based on existing models?

The structure of S. pomeroyi YidC can be predicted using several complementary approaches:

  • Evolutionary covariation analysis: Constructing a multiple sequence alignment and computing direct evolutionary couplings between pairs of residues to predict contacts between pairs of residues

  • Helix-helix contact prediction: Analyzing coupling strength matrices to identify parallel or anti-parallel helix pairs with high probability interactions (>57%)

  • Lipid exposure prediction: Determining which residues are likely to face the lipid bilayer versus the protein core

  • Molecular modeling: Using constraints from covariation analysis and secondary structure predictions through tools like Jpred 3 and MODELLER to generate structural models

For validation, molecular dynamics simulations can be performed using software like NAMD 2.9 with the CHARMM36 force field for proteins and lipids, and the TIP3P model for water . A membrane composition of 3 POPE to 1 POPG is recommended as it has been successfully used for modeling bacterial membranes in previous simulations .

What is the predicted membrane topology of YidC?

Based on structural models of YidC, the protein is predicted to have five conserved transmembrane helices that thread back-and-forth through the membrane, with portions extending into the bacterial cytoplasm . The transmembrane helices form a rigid protein core, while the polar loop regions tend to interact with the membrane surface . Key features include:

  • A hydrophobic exterior on the transmembrane bundle that stabilizes interactions with apolar lipid tails

  • A core stabilized by inter-helical interactions

  • Polar or charged residues toward the cytoplasmic side engaged in electrostatic or charge-dipole interactions

  • Aromatic residues on the periplasmic side involved in stacking and nonpolar dispersion interactions

What critical residues determine YidC function based on structural and mutational analyses?

Molecular dynamics simulations and experimental validation have identified several critical residues important for YidC function:

Residue PositionLocationRole in FunctionEffect of Alanine Mutation
T362TM2Core stabilizationComplete inactivation of YidC
Y517TM6Core stabilizationComplete inactivation of YidC
F433Near coreSubstrate interactionIntermediate activity level
M471Near coreSubstrate interactionIntermediate activity level
F505Near coreSubstrate interactionIntermediate activity level

These residues, particularly T362 in TM2 and Y517 in TM6 (which are located at the same height in the membrane), are crucial for YidC function. When mutated to alanine, despite stable expression, they completely inactivate the protein . Residues further from this critical pair show progressively less impact on function when mutated .

How does YidC interact with ribosomes during co-translational protein insertion?

YidC interacts with the ribosome at the site where the newly formed protein chain exits the ribosome, facilitating co-translational membrane protein insertion . The interaction involves specific amino acids in YidC that have been identified through a combination of theoretical modeling and experimental approaches . This ribosome-YidC interaction creates a protected environment for nascent membrane proteins to fold properly and insert into the lipid bilayer. The exiting nascent chain is received by specific residues in YidC that guide the membrane protein toward its eventual exit from YidC and insertion into the membrane .

How does S. pomeroyi YidC potentially contribute to the organism's unique adaptations to marine environments?

Silicibacter pomeroyi has evolved unique adaptations for surviving in nutrient-poor oceanic environments, including a lithoheterotrophic strategy that utilizes inorganic compounds like carbon monoxide and sulfide to supplement heterotrophy . The YidC in S. pomeroyi likely plays a critical role in inserting specialized membrane proteins that facilitate:

  • Uptake of algal-derived compounds

  • Utilization of metabolites from reducing microzones

  • Support for rapid growth when nutrients become available

  • Cell-density-dependent regulation

These specialized membrane proteins would require proper insertion into the bacterial membrane, a process likely dependent on YidC. The specific adaptations in S. pomeroyi YidC may reflect evolutionary optimization for functioning in marine environments with fluctuating nutrient availability.

How does YidC in Gram-negative marine bacteria compare to other YidC homologs?

While direct comparative data between S. pomeroyi YidC and other homologs is limited in the available search results, general comparisons can be made:

  • Conservation: YidC homologs exist across bacteria, archaea, mitochondria (Oxa1p), and chloroplasts, indicating the fundamental importance of this insertion mechanism

  • Structural features: The core transmembrane structure is likely conserved, with possible variations in the non-conserved regions like the first transmembrane helix (TM1) and P1 domain

  • Substrate specificity: S. pomeroyi YidC may have evolved to recognize specific substrates important for marine bacterial adaptation, particularly those involved in its lithoheterotrophic metabolism

  • Environmental adaptations: As S. pomeroyi lives in a marine environment with different physical conditions (salinity, pressure, temperature) compared to other bacteria, its YidC might show adaptations in terms of stability and functional dynamics under these conditions

What genomic context surrounds the yidC gene in S. pomeroyi and how does this compare to other bacteria?

The specific genomic context of yidC in S. pomeroyi is not detailed in the search results, but genomic context analysis would typically examine:

  • Gene neighborhood: Identifying genes that consistently appear near yidC across related species, which might indicate functional relationships

  • Operon structure: Determining if yidC is part of an operon in S. pomeroyi and how this compares to arrangements in other bacteria

  • Regulatory elements: Analyzing promoter regions and transcription factor binding sites that might indicate specialized regulation

  • Evolutionary conservation: Comparing synteny around the yidC locus across the Roseobacter clade and other bacterial groups

What are promising approaches for studying YidC-substrate interactions in marine bacteria?

Several advanced methodological approaches could advance our understanding of YidC-substrate interactions in S. pomeroyi:

  • Crosslinking mass spectrometry: Identifying direct protein-protein interactions between YidC and its substrates in vivo

  • Cryo-electron microscopy: Obtaining structural information of YidC-substrate complexes during the insertion process

  • Single-molecule FRET: Tracking conformational changes during substrate interactions

  • In silico substrate prediction: Developing computational tools to predict potential YidC substrates based on sequence characteristics

  • Comparative proteomics: Identifying membrane proteins whose biogenesis is affected by YidC depletion

These approaches would help identify the specific substrate repertoire of S. pomeroyi YidC and elucidate how it contributes to the organism's ecological niche in marine environments.

How might the study of S. pomeroyi YidC contribute to broader understanding of membrane protein biogenesis in marine microorganisms?

S. pomeroyi represents an important model organism for the Roseobacter clade, which constitutes 10-20% of coastal and oceanic mixed-layer bacterioplankton . Understanding its YidC function could:

  • Reveal adaptations in membrane protein insertion mechanisms that enable survival in marine environments

  • Identify novel membrane proteins involved in the organism's unique lithoheterotrophic metabolism

  • Provide insights into how marine bacteria respond to changing environmental conditions through membrane protein adaptations

  • Establish patterns of co-evolution between insertion machinery like YidC and their substrates in specialized ecological niches

  • Contribute to biotechnological applications involving the expression of marine bacterial membrane proteins

This research direction would bridge the gap between structural biology, membrane biophysics, and marine microbial ecology, advancing our understanding of how fundamental cellular processes adapt to specialized environmental conditions.

What molecular dynamics simulation parameters are optimal for studying S. pomeroyi YidC?

Based on successful approaches with other YidC proteins, the following simulation parameters are recommended:

  • Simulation software: NAMD 2.9 with CHARMM36 force field for proteins and lipids

  • Water model: TIP3P for simulating the aqueous environment

  • Membrane composition: 3 POPE to 1 POPG ratio, which has been validated for bacterial membrane simulations

  • Initial membrane surface: Approximately 110 Å × 110 Å constructed along the XY plane

  • Solvation parameters: 25 Å thick layers of water along the Cartesian Z directions

  • Ionization: Charge neutralization using Monte Carlo sampling of Na+ ions

  • Simulation duration: Minimum of 100 ns for adequate sampling of conformational space

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.