Recombinant Silicibacter pomeroyi NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Silicibacter pomeroyi NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Silicibacter pomeroyi NADH-quinone oxidoreductase subunit K (nuoK) is a full-length protein derived from the marine bacterium Silicibacter pomeroyi (formerly Ruegeria pomeroyi). This subunit belongs to the proton-translocating NADH:quinone oxidoreductase (Complex I) family, a critical enzyme in bacterial respiratory chains that couples NADH oxidation to quinone reduction and proton translocation . The recombinant form is engineered for research applications, including structural studies, functional assays, and antibody production .

Functional Role in Complex I

nuoK is a membrane-bound subunit critical for:

  • Proton Translocation: Contributes to the proton-pumping mechanism via conserved acidic residues (e.g., Glu-36 and Glu-72), which are essential for coupling electron transfer to H⁺ transport .

  • Quinone Reduction: Facilitates electron transfer between NADH and quinones, a process integral to energy generation in aerobic respiration .

  • Subunit Assembly: Interacts with other Complex I subunits (e.g., NuoH, NuoM) to maintain structural integrity and enzymatic activity .

Recombinant Production and Purification

The recombinant nuoK is produced in E. coli and purified to >90% homogeneity. Key applications include:

  • Structural Studies: His-tagged nuoK enables affinity chromatography-based purification for crystallography or cryo-EM .

  • Functional Assays: Used to study proton-pumping mechanisms, quinone-binding kinetics, and subunit interactions .

  • Antibody Development: Serves as an antigen for generating specific antibodies in ELISA kits (e.g., CSB-CF692435SAAC) .

ELISA Applications

ParameterDetail
Quantity50 µg per vial
Storage-20°C (long-term), 4°C (short-term)
BufferTris-based, 50% glycerol, pH 8.0
ApplicationsQuantitative detection of nuoK in bacterial lysates or purified samples

Functional Conservation

nuoK shares conserved residues with homologs in E. coli, Klebsiella pneumoniae, and mitochondrial ND4L, highlighting its universal role in proton translocation . For example:

  • Glutamic Acid Residues: Mutations in Glu-36 (E36) or Glu-72 (E72) in E. coli NuoK abolish proton pumping, mirroring findings in S. pomeroyi .

  • Cytosolic Arginine Pairs: Arginine residues on cytosolic loops stabilize proton translocation, as demonstrated in K. pneumoniae .

Divergence in Sodium vs. Proton Transport

While S. pomeroyi nuoK is part of a proton-translocating Complex I, some bacterial homologs (e.g., Vibrio cholerae NQR) pump sodium ions instead. This divergence underscores evolutionary adaptations in energy conservation .

Production and Handling Considerations

ParameterRecommendation
ReconstitutionUse deionized sterile water; add 5–50% glycerol for long-term storage
Freeze-Thaw CyclesAvoid repeated cycles; aliquot for single-use
StabilityWorking aliquots stable at 4°C for ≤1 week

Mechanistic Insights

  • Proton Pathway: Studies on E. coli NuoK suggest that conserved acidic residues act as proton carriers, with mutations disrupting electrochemical gradient formation .

  • Na⁺ Competitiveness: In K. pneumoniae, Na⁺ binding to NuoH (a related subunit) inhibits DCCD modification, implying a shared mechanism for ion binding .

  • Complex Assembly: Deletion of nuoK in E. coli disrupts Complex I assembly, emphasizing its structural role .

Biotechnological Relevance

The recombinant nuoK enables:

  • Drug Target Studies: Investigations into inhibitors targeting proton translocation in pathogenic bacteria .

  • Bioenergetic Modeling: Insights into quinone reduction and energy coupling in marine heterotrophs like S. pomeroyi .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
nuoK; SPO2766; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi)
Target Names
nuoK
Target Protein Sequence
MIGLEHYLTVAATLFVIGIFGLFLNRKNVIVLLMSIELMLLAVNINLVAFSSFLGDLVGQ VFTLFVLTVAAAEAAIGLAILVCFFRNRGTIDVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: sil:SPO2766

STRING: 246200.SPO2766

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) in Silicibacter pomeroyi?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the NADH-quinone oxidoreductase complex (also known as Complex I) in Silicibacter pomeroyi, a marine bacterium. This 101-amino acid protein plays a crucial role in electron transport processes, contributing to the energy metabolism of the bacterium. The protein has a transmembrane nature, as suggested by its amino acid sequence which contains hydrophobic regions characteristic of membrane-embedded proteins. In Silicibacter pomeroyi, nuoK is encoded by the gene SPO2766 and functions as part of the larger NADH dehydrogenase I complex that catalyzes the transfer of electrons from NADH to quinones in the respiratory chain .

What is the relationship between Silicibacter pomeroyi and Ruegeria pomeroyi?

Silicibacter pomeroyi and Ruegeria pomeroyi refer to the same organism. The bacterium was originally classified as Silicibacter pomeroyi but was later reclassified as Ruegeria pomeroyi . The strain designation DSS-3 is maintained across both classifications. This taxonomic update reflects improved understanding of the phylogenetic relationships within the Roseobacter clade, a group that comprises approximately 10-20% of coastal and oceanic mixed-layer bacterioplankton . The genome sequence published in 2004 was originally described as being from Silicibacter pomeroyi, representing the first genome sequence from any major heterotrophic marine bacterial clade .

How does NADH-quinone oxidoreductase contribute to the metabolism of Silicibacter pomeroyi?

NADH-quinone oxidoreductase plays a critical role in the energy metabolism of Silicibacter pomeroyi by participating in the respiratory electron transport chain. S. pomeroyi employs a lithoheterotrophic strategy, using both organic compounds (heterotrophy) and inorganic compounds like carbon monoxide and sulfide (lithotrophy) for energy acquisition .

The NADH-quinone oxidoreductase complex, of which nuoK is a subunit, contributes to this metabolism by:

  • Oxidizing NADH produced during the catabolism of organic compounds, regenerating NAD+ for continued metabolic processes

  • Transferring electrons to quinones in the membrane, which can then be passed to terminal electron acceptors

  • Pumping protons across the membrane, contributing to the proton-motive force used for ATP synthesis

  • Potentially participating in the electron transport pathways linked to the oxidation of inorganic compounds like sulfite and thiosulfate, as S. pomeroyi possesses genes for these processes

This respiratory flexibility, with NADH-quinone oxidoreductase as a key component, likely contributes to S. pomeroyi's success in marine environments where nutrient availability can be variable and limiting .

What are the challenges in expressing and purifying recombinant Silicibacter pomeroyi nuoK protein?

Expressing and purifying recombinant Silicibacter pomeroyi nuoK protein presents several significant challenges, primarily due to its nature as a small (101 amino acids), hydrophobic membrane protein. These challenges include:

  • Membrane Protein Solubility: The hydrophobic nature of nuoK makes it inherently difficult to solubilize in aqueous solutions without appropriate detergents or lipid environments.

  • Proper Folding: Ensuring proper folding of the recombinant protein in heterologous expression systems like E. coli (used for the product described in the literature) is challenging for membrane proteins, which often require specific membrane environments for correct folding .

  • Expression Levels: Membrane proteins typically express at lower levels than soluble proteins, potentially necessitating optimization of expression conditions, including temperature, induction parameters, and host strain selection.

  • Toxicity to Host Cells: Overexpression of membrane proteins can be toxic to host cells, potentially limiting yield and requiring careful control of expression levels.

  • Purification Complexity: The need for detergents throughout the purification process adds complexity and can affect protein stability and downstream applications.

  • Protein Stability: As noted in the storage recommendations for the recombinant protein, membrane proteins often have stability issues, requiring careful handling, storage in appropriate buffers, and avoidance of repeated freeze-thaw cycles .

To address these challenges, researchers have employed strategies such as fusion tags (the His-tag mentioned in product descriptions), optimized expression systems, and careful buffer formulation including trehalose as a stabilizing agent .

What structural features of nuoK contribute to its functional role in electron transport?

While direct structural analysis of Silicibacter pomeroyi nuoK is not extensively documented in the literature, key structural features can be inferred from its amino acid sequence and from general principles of NADH-quinone oxidoreductase structure, combined with insights from the structural analysis of related quinone oxidoreductases:

  • Transmembrane Helices: Analysis of the nuoK amino acid sequence reveals hydrophobic segments likely to form transmembrane helices . These helices likely contribute to forming the proton translocation pathway within the membrane domain of Complex I.

  • Conserved Residues: Within the transmembrane regions, certain conserved residues would likely participate in:

    • Quinone binding

    • Proton translocation

    • Interactions with adjacent subunits

  • Interface Regions: Based on the structure of related quinone oxidoreductases, which can function as homodimers where "both active sites comprise residues from both subunits," nuoK likely contains regions that interface with other subunits of Complex I, contributing to the formation of a functional enzyme complex .

  • Conformational Flexibility: The importance of "mobility" and "flexibility" for enzyme function, as highlighted for related quinone oxidoreductases, suggests that nuoK likely contains regions with conformational flexibility important for electron transport and/or proton pumping .

  • Cofactor Interactions: While nuoK itself may not bind cofactors directly, its position within the Complex I structure likely places it in proximity to redox-active cofactors like iron-sulfur clusters.

To fully characterize how these structural features contribute to function would require high-resolution structural studies (X-ray crystallography or cryo-EM), site-directed mutagenesis of key residues, and functional assays measuring electron transport and proton pumping.

What experimental approaches can be used to study the protein-protein interactions of nuoK with other subunits of the NADH-quinone oxidoreductase complex?

To study the protein-protein interactions of nuoK with other subunits of the NADH-quinone oxidoreductase complex in Silicibacter pomeroyi, researchers can employ several complementary experimental approaches:

  • Crosslinking Studies: Chemical crosslinking agents can capture transient interactions between nuoK and neighboring subunits. Subsequent mass spectrometry analysis can identify crosslinked residues, providing information about interaction interfaces.

  • Co-Immunoprecipitation (Co-IP): Using antibodies against tagged versions of nuoK (such as the His-tagged version available commercially) to pull down the protein along with interacting partners, followed by identification using mass spectrometry .

  • Bacterial Two-Hybrid System: Adapting bacterial two-hybrid approaches to investigate direct interactions between nuoK and other subunits, particularly useful for screening potential interactions.

  • Surface Plasmon Resonance (SPR): Using purified components to quantitatively measure binding affinities and kinetics between nuoK and other subunits.

  • Förster Resonance Energy Transfer (FRET): Tagging nuoK and potential partner subunits with appropriate fluorophores to detect proximity and interactions in intact cells or membrane preparations.

  • Native Gel Electrophoresis: Blue native PAGE to analyze intact complexes and subcomplexes, particularly useful for detecting assembly defects caused by mutations in interaction interfaces.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): To map regions of nuoK that are protected from solvent exchange due to interactions with other subunits.

What role does nuoK play in the adaptation of Silicibacter pomeroyi to marine environments?

While direct experimental evidence about the specific role of nuoK in Silicibacter pomeroyi's adaptation to marine environments is limited, several potential adaptive roles can be proposed based on S. pomeroyi's ecological adaptations:

  • Energy Efficiency in Nutrient-Limited Environments: As part of the NADH-quinone oxidoreductase complex, nuoK contributes to energy conservation through proton pumping. In the "nutrient-poor ocean," efficient energy transduction would be selectively advantageous, and the specific properties of S. pomeroyi nuoK might be optimized for this environment .

  • Integration with Lithoheterotrophic Metabolism: S. pomeroyi "relies upon a lithoheterotrophic strategy that uses inorganic compounds (carbon monoxide and sulphide) to supplement heterotrophy" . The nuoK subunit might have specific adaptations that facilitate electron flow from these diverse metabolic pathways into the respiratory chain.

  • Compatibility with Marine-Specific Quinones: The quinone pool composition can vary across environments, and nuoK might be adapted to interact efficiently with the specific quinone types prevalent in marine environments.

  • Functional Integration with Sulfur Metabolism: Given S. pomeroyi's capacity for "oxidizing sulfite and thiosulfate," nuoK might have adaptations that facilitate electron flow from sulfur oxidation pathways .

Methodological approaches to study these adaptive roles:

  • Comparative Genomics: Analyzing nuoK sequences across marine and non-marine bacteria to identify marine-specific adaptations.

  • Experimental Evolution: Subjecting S. pomeroyi to different marine-relevant conditions and tracking changes in the nuoK gene over time.

  • Heterologous Expression: Expressing S. pomeroyi nuoK in non-marine bacteria and testing functionality under marine-like conditions.

  • Site-Directed Mutagenesis: Modifying potentially adaptive residues in nuoK and assessing impacts on function under marine-relevant conditions.

How can computational modeling be used to predict the impact of nuoK variants on NADH-quinone oxidoreductase function?

Computational modeling offers powerful approaches to predict the impact of nuoK variants on NADH-quinone oxidoreductase function in Silicibacter pomeroyi:

  • Homology Modeling: Using the amino acid sequence of S. pomeroyi nuoK and known structures of homologous proteins to generate a three-dimensional model of the protein and its position within the larger complex .

  • Molecular Dynamics (MD) Simulations: Simulating the dynamics of wild-type and variant nuoK proteins to assess:

    • Protein stability changes, similar to how "inappropriate mobility results in dysfunction" for related enzymes

    • Conformational changes that might affect function

    • Alterations in interaction interfaces with other subunits

  • Protein-Protein Docking: Modeling the interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex to predict how variants might disrupt complex assembly.

  • Electrostatic Surface Analysis: Calculating changes in the electrostatic properties of nuoK variants to predict effects on proton translocation function.

  • Evolutionary Conservation Analysis: Identifying highly conserved residues across nuoK homologs in different species, which are likely functionally important and thus more susceptible to deleterious effects when mutated.

  • Machine Learning Approaches: Training algorithms on known effects of mutations in related proteins to predict the impact of nuoK variants on protein stability, complex assembly, and catalytic efficiency.

These computational approaches provide testable hypotheses about the functional impacts of nuoK variants, guiding experimental design and helping interpret experimental results in the context of the protein's structure and function within the respiratory chain.

What are the methodological considerations for studying the electron transport chain involving nuoK in Silicibacter pomeroyi?

Studying the electron transport chain (ETC) involving nuoK in Silicibacter pomeroyi presents several methodological challenges and considerations:

  • Membrane Preparation Optimization:

    • Developing protocols for isolating intact membrane fractions that preserve native ETC functionality

    • Ensuring complete cell lysis while minimizing damage to membrane complexes

    • Selecting appropriate buffer conditions that maintain membrane integrity while allowing experimental access

  • Complex I Activity Assays:

    • Establishing reliable methods to measure NADH:quinone oxidoreductase activity in membrane preparations

    • Selecting appropriate quinone substrates relevant to S. pomeroyi's native environment

    • Developing protocols that distinguish Complex I activity from other NADH dehydrogenases

  • Genetic System Development:

    • Creating tools for targeted genetic manipulation of nuoK and related genes

    • Developing complementation systems to verify phenotypes of genetic mutants

    • Establishing inducible expression systems for controlled studies

  • Protein Expression and Purification:

    • Optimizing heterologous expression of S. pomeroyi nuoK, addressing the challenges mentioned in Section 2.1

    • Developing purification protocols that maintain native structure and interactions

    • Creating methods to reconstitute purified components into functional systems

  • Physiological Measurements:

    • Adapting methods to measure membrane potential in S. pomeroyi cells

    • Developing protocols to assess proton pumping activity specifically linked to Complex I

    • Establishing methods to measure intracellular NADH/NAD+ ratios

  • Environmental Relevance:

    • Designing experiments that mimic the "nutrient-poor ocean" conditions

    • Accounting for the "lithoheterotrophic strategy" when designing substrate conditions

    • Considering how to integrate observations of sulfur oxidation with ETC studies

  • Integration with 'Omics Approaches:

    • Leveraging proteomics approaches similar to those that identified "novel open reading frames"

    • Using transcriptomics to understand co-regulation of nuoK with other metabolic genes

    • Employing metabolomics to assess the impact of ETC perturbations

These methodological considerations highlight the interdisciplinary approach needed to comprehensively study the role of nuoK in S. pomeroyi's electron transport chain, requiring expertise in biochemistry, genetics, structural biology, and bacterial physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.