Recombinant Silicibacter pomeroyi Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Silicibacter pomeroyi and Its Genomic Context

Silicibacter pomeroyi, now reclassified as Ruegeria pomeroyi, is a marine bacterium belonging to the Roseobacter clade, which constitutes approximately 10-20% of coastal and oceanic mixed-layer bacterioplankton . This Gram-negative, rod-shaped, aerobic bacterium was discovered off the eastern coast of the United States in the laboratory of Mary Ann Moran at the University of Georgia . The bacterium was named after Lawrence "Larry" Pomeroy, a marine microbial ecologist who established the pivotal role of marine bacteria in ocean food web dynamics .

The genome of R. pomeroyi consists of a chromosome (4,109,442 base pairs) and a megaplasmid (491,611 base pairs), containing a total of 4,283 predicted coding sequences . Unlike many marine oligotrophs, R. pomeroyi employs a lithoheterotrophic strategy, utilizing inorganic compounds such as carbon monoxide and sulfide to supplement heterotrophy, making it well-adapted to nutrient-poor marine environments .

Within this genetic blueprint, the uppP gene encodes the Undecaprenyl-diphosphatase enzyme, which plays an essential role in bacterial cell wall biosynthesis by facilitating the recycling of lipid carriers necessary for cell envelope components synthesis. The genome of R. pomeroyi shows a higher proportion of genes coding for signal transduction (1.6%) and transport/binding proteins (12.1%) compared to other α-Proteobacteria, highlighting its adaptability and metabolic versatility .

Biochemical Properties and Function

Undecaprenyl-diphosphatase catalyzes the following reaction:

Undecaprenyl pyrophosphate + H₂O → Undecaprenyl phosphate + Phosphate

This hydrolysis reaction is essential for the recycling of the C55 lipid carrier in bacterial cell wall biosynthesis. The enzyme functions at the membrane interface, where it dephosphorylates UPP to generate Und-P, which then serves as a substrate for peptidoglycan and wall teichoic acid synthases .

Table 1: Enzymatic Properties of uppP

PropertyDescription
EC Number3.6.1.27
Reaction TypeHydrolysis
SubstrateUndecaprenyl pyrophosphate (UPP)
ProductsUndecaprenyl phosphate (Und-P) and inorganic phosphate
CofactorsNot required
Cellular LocationCytoplasmic membrane
FunctionRecycling of lipid carrier for cell wall synthesis

Expression Systems and Purification

Recombinant S. pomeroyi uppP is typically expressed in heterologous host systems such as Escherichia coli for research and commercial applications. Based on available information, the recombinant protein can be produced with various tags to facilitate purification and detection .

Applications of Recombinant uppP

Recombinant uppP proteins serve as valuable research tools for:

  1. Enzymatic assays to study the kinetics and mechanism of UPP dephosphorylation

  2. Structural studies to understand the enzyme's active site and binding properties

  3. High-throughput screening for inhibitor discovery

  4. Antibody production for detection and localization studies

  5. ELISA-based applications for quantitative analysis

The Lipid II Cycle

  1. UPP synthesis: Undecaprenyl pyrophosphate synthase (UppS) catalyzes the formation of the C55 lipid carrier UPP by condensing farnesyl diphosphate with eight isopentenyl diphosphate molecules.

  2. UPP dephosphorylation: UPP phosphatase (uppP) converts UPP to Und-P.

  3. Lipid I formation: MraY enzyme transfers UDP-N-acetylmuramyl-pentapeptide to Und-P to form Lipid I.

  4. Lipid II formation: Addition of N-acetylglucosamine to Lipid I by MurG.

  5. Translocation: Lipid II is flipped across the cytoplasmic membrane.

  6. Peptidoglycan synthesis: The disaccharide-pentapeptide portion is incorporated into the growing peptidoglycan network, releasing UPP.

  7. Recycling: UPP is dephosphorylated by uppP to regenerate Und-P, completing the cycle.

Functional Redundancy and Essentiality

Studies in Bacillus subtilis have demonstrated that bacteria often possess functional redundancy in UPP phosphatases. B. subtilis requires either of two UPP phosphatases, UppP or BcrC, for viability . Additionally, a third predicted lipid phosphatase (YodM) can support growth when overexpressed . This functional redundancy highlights the critical importance of this enzymatic activity for bacterial survival.

Depletion of UPP phosphatase activity leads to morphological defects consistent with cell envelope synthesis failure and strongly activates cell envelope stress responses . While specific studies on S. pomeroyi uppP functional redundancy are not detailed in the search results, it likely serves a similarly critical function in this marine bacterium.

Targeting the Lipid II Cycle

The essential nature of the lipid II cycle in bacterial cell wall biosynthesis makes it an attractive target for antibiotic development. Several existing antibiotics target various steps in this pathway :

  1. Bacitracin: Binds to UPP, preventing its dephosphorylation by uppP

  2. Fosfomycin and D-cycloserine: Interfere with early steps of cell wall synthesis

  3. β-lactams and vancomycin: Target late stages of peptidoglycan assembly

Interestingly, research has shown that mutations affecting UppS levels (which produces the substrate for uppP) can confer resistance to vancomycin in B. subtilis . This illustrates the complex interplay between different steps in the lipid II cycle and antibiotic resistance mechanisms.

Developing Novel Inhibitors

The emergence of antibiotic resistance has emphasized the need for new antimicrobial compounds targeting essential bacterial processes. Research on UppS inhibitors has made significant progress, with several compounds showing promising activity against bacterial growth . By extension, uppP represents another potential target in the same pathway.

Development of uppP inhibitors could provide novel antibiotics or potentiators that restore the efficacy of existing antibiotics. The conservation of uppP across bacterial species suggests that such inhibitors might have broad-spectrum activity, although selective toxicity would need to be established.

Current Research Applications

Recombinant S. pomeroyi uppP has several important research applications:

  1. Mechanistic Studies: Investigating the catalytic mechanism of UPP dephosphorylation

  2. Comparative Enzymology: Comparing the properties of uppP from different bacterial species

  3. Inhibitor Screening: Identifying compounds that specifically inhibit uppP activity

  4. Structural Biology: Determining the three-dimensional structure of the enzyme to facilitate structure-based drug design

  5. Cell Wall Biosynthesis Research: Understanding the coordination between different steps in bacterial cell wall synthesis

Future Research Directions

Future research involving S. pomeroyi uppP may include:

  1. Structural Characterization: Resolving the crystal structure of the enzyme to identify binding sites and catalytic residues

  2. Inhibitor Development: Designing specific inhibitors based on structural information

  3. Resistance Mechanisms: Understanding how bacteria develop resistance to uppP inhibitors

  4. Combination Therapies: Exploring synergistic effects of targeting multiple steps in the lipid II cycle

  5. Ecological Role: Investigating the specific adaptations of S. pomeroyi uppP to marine environments

  6. Industrial Applications: Exploring biotechnological applications in lipid metabolism or bacterial cell factories

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; SPO3771; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi)
Target Names
uppP
Target Protein Sequence
MSLFHLILVALIQGITEFLPVSSSGHLILLPALTGLEDQGQVIDVAVHVGTLGAVVLYFW RDVRDGLAGLPRALTGRLDTPGARLAMGLIVATIPTVLAGAALHFTGLSDALRSITVIGW TMLLFGLLLWWADRTGAQVKEATDWSLRDALILGLWQAVALIPGTSRSGITITGARAMGY TRSDGARISMLMSIPTIIASGVLLGADVAVTSDAQAARDGAIAAAFAFVSALLALSLMMR LLRSVSFTPYVIYRLALGLVLLGIAYS
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links

KEGG: sil:SPO3771

STRING: 246200.SPO3771

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Silicibacter pomeroyi and why is it significant for uppP research?

Silicibacter pomeroyi is a member of the marine Roseobacter clade, comprising approximately 10-20% of coastal and oceanic mixed-layer bacterioplankton. It represents the first sequenced genome from a major heterotrophic marine clade, consisting of a chromosome (4,109,442 base pairs) and a megaplasmid (491,611 base pairs) . S. pomeroyi employs a lithoheterotrophic strategy that uses inorganic compounds like carbon monoxide and sulfide to supplement heterotrophy, representing a distinct physiological adaptation to nutrient-poor ocean environments . The organism has genes that facilitate associations with plankton and suspended particles, including those for uptake of algal-derived compounds and use of metabolites from reducing microzones . These characteristics make S. pomeroyi an excellent model organism for studying bacterial cell wall biosynthesis enzymes like uppP in marine environments, offering insights into adaptation mechanisms in oceanic ecosystems.

What is the function of Undecaprenyl-diphosphatase (uppP) in bacterial systems?

Undecaprenyl-diphosphatase (uppP), also sometimes referred to as Undecaprenyl diphosphate phosphatase (UPPP), plays a critical role in bacterial cell wall biosynthesis. This enzyme catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) . This conversion is essential because UP serves as a lipid carrier for peptidoglycan precursors across the cytoplasmic membrane during cell wall synthesis. The reaction represents a crucial step in the recycling pathway of the lipid carrier, ensuring continuous cell wall biosynthesis. Since this pathway is absent in humans and essential for bacterial viability, uppP represents a potential target for antimicrobial development, particularly important in marine bacterial systems like S. pomeroyi where cell wall integrity is critical for survival in changing oceanic conditions.

How does uppP integrate into S. pomeroyi's metabolic pathways?

In S. pomeroyi, uppP functions within the isoprenoid biosynthesis pathway that ultimately leads to cell wall construction. The pathway begins with the condensation of isopentenyl diphosphate (IPP) molecules to form farnesyl diphosphate (FPP) through the action of farnesyl diphosphate synthase (FPPS). Subsequently, undecaprenyl diphosphate synthase (UPPS) catalyzes the condensation of FPP with eight additional IPP molecules to form undecaprenyl diphosphate (UPP) . At this point, uppP converts UPP to undecaprenyl phosphate (UP), which serves as the lipid carrier for cell wall precursors.

This pathway is particularly interesting in S. pomeroyi given its genomic adaptations for marine environments. The organism contains a proportionally higher number of genes involved in transport and binding proteins (12.1% versus 8.1 ± 3.0% in other α-Proteobacteria) and signal transduction (1.6% versus 0.23 ± 0.39%) . These genomic features suggest that cell envelope maintenance and modification, including the pathways involving uppP, may be particularly important for S. pomeroyi's adaptation to changing marine conditions.

What are the optimal approaches for recombinant expression of S. pomeroyi uppP?

When expressing recombinant S. pomeroyi uppP, researchers should consider several methodological factors to maximize protein yield and activity. The experimental design process should follow these steps:

  • Vector selection: Choose expression vectors with promoters that allow tight regulation (such as T7 or tac promoters) and include affinity tags (His6 or GST) for purification.

  • Host strain optimization: E. coli BL21(DE3) derivatives are recommended due to their reduced protease activity. For membrane proteins like uppP, C41(DE3) or C43(DE3) strains often provide better results.

  • Expression conditions: Implement a carefully designed screening experiment to identify optimal conditions:

    • Temperature: Test expression at 16°C, 25°C, and 37°C

    • Induction timing: Induce at OD600 between 0.6-0.8

    • Inducer concentration: Test IPTG at 0.1 mM, 0.5 mM, and 1.0 mM

    • Media composition: Compare LB, TB, and auto-induction media

Following the experimental design process outlined by ACS (Figure 1), researchers should first define clear objectives, select appropriate factors to study, choose measurable responses, and execute the experiments with precision . This systematic approach allows for more efficient optimization of expression conditions through well-designed screening experiments.

What methods are recommended for purification and activity assays of S. pomeroyi uppP?

Purification and activity assessment of S. pomeroyi uppP requires specific methodological considerations:

Purification Protocol:

  • Cell lysis: Use sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors.

  • Membrane fraction isolation: Centrifuge lysate at 10,000×g for 20 minutes to remove debris, then ultracentrifuge at 100,000×g for 1 hour to collect membrane fractions.

  • Detergent solubilization: Solubilize membrane pellet with 1% n-dodecyl-β-D-maltoside (DDM) or 1% n-octyl-β-D-glucopyranoside (OG).

  • Affinity chromatography: Purify using Ni-NTA or other appropriate affinity resin based on the chosen tag.

  • Size exclusion chromatography: Further purify using gel filtration to obtain homogeneous protein preparation.

Activity Assay Methods:

  • Phosphate release assay: Measure inorganic phosphate released from UPP using malachite green or similar colorimetric methods.

  • HPLC-based assay: Monitor the conversion of UPP to UP using reverse-phase HPLC.

  • Coupled enzyme assay: Link phosphate release to NADH oxidation through auxiliary enzymes for continuous monitoring.

For reliable results, researchers should implement proper controls including enzyme-free reactions, heat-inactivated enzyme controls, and known phosphatase inhibitor controls. When analyzing experimental data, statistical methods should be employed to establish relationships between experimental factors and enzyme activity response .

How can researchers determine the kinetic parameters of S. pomeroyi uppP?

Determining accurate kinetic parameters for S. pomeroyi uppP requires careful experimental design and analytical approaches:

Experimental Setup:

  • Prepare reaction mixtures containing varying concentrations of UPP substrate (typically 5-10 concentrations ranging from 0.1× to 10× the estimated Km).

  • Maintain constant enzyme concentration within the linear range of activity.

  • Control temperature (typically 25°C or 30°C) and pH (around pH 7.5-8.0) throughout experiments.

  • Include appropriate buffer systems (50 mM Tris-HCl or HEPES) and necessary cofactors (often Mg2+ at 5-10 mM).

Data Collection and Analysis:

  • Measure initial reaction velocities at each substrate concentration, ensuring measurements occur within the linear phase (<10% substrate consumption).

  • Plot reaction velocities against substrate concentrations.

  • Fit data to appropriate kinetic models:

    • Michaelis-Menten equation for standard hyperbolic kinetics

    • Hill equation if cooperativity is observed

    • Appropriate models for inhibition studies

Parameters to Determine:

  • Km (Michaelis constant): Substrate concentration at half-maximal velocity

  • kcat (turnover number): Maximum number of substrate molecules converted per enzyme molecule per second

  • kcat/Km: Catalytic efficiency

  • Hill coefficient (if cooperative behavior is observed)

The experimental design process should include verification steps to ensure enzyme stability throughout the assay period and to confirm that product inhibition is not affecting results . Additionally, researchers should implement statistical analysis to determine confidence intervals for the calculated parameters and to ensure reproducibility.

How does S. pomeroyi uppP compare structurally and functionally to homologs from other bacteria?

While specific structural data on S. pomeroyi uppP is limited, comparative genomic and functional analyses provide valuable insights:

Structural Comparisons:
S. pomeroyi uppP likely shares the core structural features found in other bacterial undecaprenyl-diphosphatases, which typically contain multiple transmembrane domains. The enzyme is expected to have a catalytic site accessible from the periplasmic side of the membrane, with conserved active site residues including aspartic acid, which functions in nucleophilic attack during phosphate removal.

Functional Adaptations:
S. pomeroyi's genomic adaptations to marine environments suggest potential functional specializations in its uppP. The bacterium possesses a higher proportion of genes involved in transport and binding proteins (12.1% versus 8.1 ± 3.0% in other α-Proteobacteria) , indicating potential adaptations in membrane-associated proteins like uppP to function optimally in changing marine conditions.

Comparative Analysis Table:

FeatureS. pomeroyi uppPE. coli uppPB. subtilis uppP
Predicted TM domains6-8 (estimated)66
Optimal pH~7.5-8.0 (marine adaptation)~7.0~7.5
Cation requirementMg2+ (predicted)Mg2+Mg2+
Inhibitor sensitivityUnknownBacitracinBacitracin
Cellular localizationInner membraneInner membraneCytoplasmic membrane

Note: Some values are predicted based on homology and environmental adaptations rather than direct experimental measurement.

What approaches can be used to identify potential inhibitors of S. pomeroyi uppP?

Identifying inhibitors of S. pomeroyi uppP requires a multifaceted approach:

1. Structure-Based Virtual Screening:

  • Develop homology models of S. pomeroyi uppP based on known bacterial homologs

  • Identify binding pockets through computational analysis

  • Screen virtual libraries of compounds using molecular docking

  • Prioritize compounds based on predicted binding energies and interactions with catalytic residues

2. High-Throughput Biochemical Screening:

  • Adapt uppP activity assays to microplate format for high-throughput screening

  • Screen diverse chemical libraries, including natural product extracts from marine environments

  • Implement counter-screens to eliminate compounds with non-specific mechanisms or high toxicity

3. Fragment-Based Drug Discovery:

  • Screen libraries of low molecular weight compounds (fragments) against purified S. pomeroyi uppP

  • Identify fragments that bind with moderate affinity

  • Link or grow fragments to develop more potent inhibitors

4. Repurposing Known Bacterial Cell Wall Inhibitors:

  • Test compounds known to inhibit related phosphatases or other enzymes in bacterial cell wall biosynthesis

  • Focus on compounds that specifically target undecaprenyl-diphosphatases in other bacterial systems

Research indicates that bacterial cell wall inhibitors targeting undecaprenyl processing enzymes have been successfully identified in related systems . These approaches, particularly when focused on marine-specific compounds, may yield novel inhibitors with potential applications in understanding S. pomeroyi cell wall biosynthesis and developing marine-specific antimicrobials.

How can site-directed mutagenesis be used to investigate the catalytic mechanism of S. pomeroyi uppP?

Site-directed mutagenesis provides a powerful approach to elucidate the catalytic mechanism of S. pomeroyi uppP:

Experimental Design Framework:

  • Target residue identification: Based on sequence alignments with characterized uppP homologs, identify conserved residues likely involved in:

    • Substrate binding (typically basic and hydrophobic residues)

    • Catalysis (often aspartic acid, histidine, or serine residues)

    • Metal coordination (typically aspartic acid, histidine, or glutamic acid)

  • Mutagenesis strategy:

    • Conservative substitutions: Replace residues with structurally similar amino acids (e.g., Asp→Glu) to probe specific chemical requirements

    • Non-conservative substitutions: Replace with functionally distinct amino acids (e.g., Asp→Ala) to eliminate specific functional groups

    • Create a panel of single and double mutants to investigate potential cooperative effects

  • Functional characterization:

    • Express and purify each mutant protein following standardized protocols

    • Determine kinetic parameters (Km, kcat, kcat/Km) for each mutant

    • Assess metal ion dependence and pH profiles to probe mechanistic changes

    • Examine substrate specificity alterations using substrate analogs

  • Structural impact analysis:

    • Use circular dichroism to assess secondary structure changes

    • Employ thermal shift assays to evaluate protein stability

    • If possible, obtain crystal structures of key mutants

The experimental process should follow established design principles, ensuring appropriate controls and statistical analysis of results . For each mutant, researchers should systematically vary one factor at a time while controlling all other conditions, allowing for direct comparison of effects across the mutation panel.

How can researchers address low expression or insolubility of recombinant S. pomeroyi uppP?

When facing challenges with low expression or insolubility of recombinant S. pomeroyi uppP, researchers should implement a systematic troubleshooting approach:

For Low Expression:

  • Codon optimization: Analyze the S. pomeroyi uppP gene for rare codons in the expression host and synthesize a codon-optimized version.

  • Expression vector modification: Test different promoter strengths and ribosome binding site variations.

  • Host strain selection: Compare expression levels in multiple E. coli strains (BL21, Rosetta, Arctic Express).

  • Culture conditions optimization: Implement a factorial design experiment testing:

    • Temperature (16°C, 25°C, 30°C)

    • Media composition (LB, TB, M9 minimal media)

    • Induction timing (early, mid, late log phase)

    • Inducer concentration gradient

For Insolubility Issues:

  • Fusion tags: Test solubility-enhancing fusion partners (MBP, SUMO, thioredoxin).

  • Buffer optimization: Screen different buffer systems, pH ranges, and salt concentrations.

  • Detergent screening: For membrane proteins like uppP, systematically test multiple detergents:

    • Mild detergents: DDM, OG, LDAO

    • Mixed micelles: Combinations of detergents with lipids

    • Amphipols or nanodiscs for maintaining native-like membrane environment

Experimental Design Considerations:
Following established experimental design principles , researchers should implement screening experiments in the early stages to identify promising conditions, followed by optimization experiments focusing on the most influential factors. For complex expression issues, a full factorial design may be necessary to identify interaction effects between multiple variables.

What are potential causes and solutions for inconsistent activity in S. pomeroyi uppP assays?

Inconsistent activity in S. pomeroyi uppP assays can stem from multiple sources, each requiring specific remediation strategies:

Common Causes and Solutions:

  • Enzyme Instability:

    • Cause: Denaturation or aggregation during storage or assay

    • Solution: Add stabilizers (glycerol 10-20%, reducing agents like DTT or βME at 1-5 mM), optimize storage buffer, prepare fresh enzyme preparations

  • Substrate Variability:

    • Cause: Degradation of UPP substrate, batch-to-batch variation

    • Solution: Verify substrate purity by analytical methods (HPLC, TLC), prepare fresh substrate solutions, include internal standards

  • Assay Component Interference:

    • Cause: Inhibitory contaminants in buffers or reagents

    • Solution: Use highest purity reagents, test different buffer systems, include positive controls with known activity

  • Enzymatic Parameters Drift:

    • Cause: pH or temperature fluctuations affecting kinetics

    • Solution: Maintain strict temperature control, verify pH stability throughout assay period, include buffer systems with adequate capacity

Quality Control Measures:

  • Include standard curves in each assay

  • Run technical triplicates of each condition

  • Implement positive controls using commercial phosphatases

  • Periodically validate assay performance using reference standards

Data Analysis Strategy:
When analyzing potentially inconsistent data, researchers should implement statistical methods to establish relationships between factors and response variables . This includes checking for outliers, assessing data distribution normality, and potentially applying transformations to stabilize variance across measurements.

How can researchers validate uppP as a potential antimicrobial target in S. pomeroyi?

Validating uppP as a potential antimicrobial target in S. pomeroyi requires a comprehensive approach combining genetic, biochemical, and physiological studies:

Genetic Validation:

  • Gene essentiality assessment:

    • Attempt gene knockout/knockdown using CRISPR-Cas9 or antisense RNA approaches

    • Implement conditional expression systems to regulate uppP levels

    • Monitor growth and morphological changes under depletion conditions

  • Complementation studies:

    • Express heterologous uppP genes to determine functional conservation

    • Create point mutations in catalytic residues to correlate enzyme activity with viability

Biochemical Validation:

  • Target engagement studies:

    • Develop activity-based protein profiling probes for uppP

    • Demonstrate specific binding of inhibitor candidates to purified uppP

    • Conduct thermal shift assays to verify inhibitor binding

  • Pathway impact analysis:

    • Measure accumulation of UPP and depletion of UP upon inhibition

    • Monitor downstream effects on peptidoglycan biosynthesis

    • Quantify changes in cell wall composition

Physiological Validation:

  • Growth inhibition correlation:

    • Establish relationship between uppP inhibition and growth inhibition

    • Determine minimum inhibitory concentrations (MICs) of validated inhibitors

    • Assess phenotypic changes (cell morphology, membrane integrity)

  • Specificity demonstration:

    • Compare effects on S. pomeroyi versus other marine bacteria

    • Evaluate inhibitor effects on mammalian cells to assess selectivity

    • Test for resistance development and characterize resistance mechanisms

Validation Decision Matrix:

Validation CriterionStrong EvidenceModerate EvidenceWeak Evidence
Genetic essentialityLethal knockoutGrowth defectNo phenotype
Target engagementDirect binding shownIndirect evidenceInconsistent results
Pathway disruptionClear accumulation of UPPModest changesNo detectable change
Growth inhibitionMIC < 10 μg/mLMIC 10-100 μg/mLMIC > 100 μg/mL
Selectivity>100× selective for bacteria10-100× selective<10× selective

This methodological approach provides a robust framework for validating S. pomeroyi uppP as an antimicrobial target while following experimental design best practices .

How might environmental factors affect uppP expression and function in S. pomeroyi?

S. pomeroyi's adaptation to marine environments suggests that environmental factors likely influence uppP expression and function. The bacterium employs a lithoheterotrophic strategy using inorganic compounds like carbon monoxide and sulfide , and has genes advantageous for associations with plankton and suspended particles . These adaptations indicate potential environmental regulation of cell envelope-related genes, including uppP.

Research Approaches:

  • Transcriptomic analysis: Compare uppP expression levels under various environmental conditions:

    • Nutrient availability (oligotrophic vs. nutrient-rich conditions)

    • Temperature ranges (reflecting oceanic temperature variations)

    • Salinity gradients (coastal vs. deep ocean conditions)

    • Association with marine particles vs. free-living state

  • Biochemical characterization: Determine how environmental factors affect uppP enzymatic properties:

    • Salt concentration effects on activity and stability

    • Temperature-dependent activity profiles

    • pH optimum shifts under different conditions

  • Protein localization studies: Investigate whether environmental conditions alter uppP cellular distribution:

    • Membrane microdomain localization under stress conditions

    • Association with other cell envelope biosynthesis proteins

    • Changes in protein abundance and turnover rates

The systematic investigation of these factors should follow established experimental design principles , implementing screening experiments to identify the most significant environmental variables before conducting detailed optimization studies.

What role might S. pomeroyi uppP play in bacterial-algal interactions in marine ecosystems?

S. pomeroyi has genes advantageous for associations with plankton and suspended particles, including genes for uptake of algal-derived compounds . This suggests potential specialized roles for cell envelope-related proteins like uppP in bacterial-algal interactions:

Research Questions and Approaches:

  • Cell wall adaptations during algal association:

    • Compare uppP expression and activity in free-living versus algae-associated S. pomeroyi

    • Investigate whether algal metabolites modulate uppP function

    • Determine if uppP-dependent modifications affect bacterial attachment to algal surfaces

  • Biofilm formation on algal surfaces:

    • Assess the role of uppP in biofilm development on algal substrates

    • Create uppP conditional mutants to evaluate attachment efficiency

    • Compare cell wall composition in planktonic versus algae-associated states

  • Signaling roles in bacterial-algal communication:

    • Investigate whether uppP-dependent cell wall modifications serve as recognition factors

    • Test if algal exudates directly affect uppP regulation

    • Examine co-transcription patterns of uppP with quorum sensing or signaling genes

This research direction could provide valuable insights into the molecular basis of bacterial-algal interactions in marine ecosystems, potentially revealing specialized functions of uppP beyond its canonical role in cell wall biosynthesis.

How does research on S. pomeroyi uppP contribute to our understanding of marine bacterial adaptation?

Research on S. pomeroyi uppP provides significant insights into marine bacterial adaptation by illuminating specialized aspects of cell envelope biosynthesis in ocean environments. S. pomeroyi represents an important model organism as a member of the Roseobacter clade, which comprises approximately 10-20% of coastal and oceanic mixed-layer bacterioplankton .

The study of uppP in this organism reveals how a core bacterial process—cell wall biosynthesis—has potentially adapted to marine conditions. S. pomeroyi employs a lithoheterotrophic strategy using inorganic compounds and has genomic features suggesting specialized membrane and transport functions, with a higher proportion of genes involved in transport and signal transduction compared to other α-Proteobacteria .

By characterizing uppP in this context, researchers gain understanding of:

  • Molecular adaptations enabling survival in oceanic environments

  • Potential specialized functions of cell envelope components in marine bacteria

  • Evolution of core bacterial processes in response to marine selective pressures

  • Biochemical adaptations to varying salinity, temperature, and nutrient availability

This research contributes to our broader understanding of how essential bacterial processes have evolved in different ecological niches, providing insights that extend beyond marine systems to fundamental principles of bacterial adaptation.

What integrative approaches can advance our understanding of S. pomeroyi uppP?

Advancing our understanding of S. pomeroyi uppP requires integrative approaches that combine multiple disciplines and methodologies:

Multi-omics Integration:

  • Genomics: Comparative analysis of uppP gene structure across marine bacteria

  • Transcriptomics: Expression patterns under various environmental conditions

  • Proteomics: Post-translational modifications and protein interaction networks

  • Metabolomics: Changes in cell wall precursors under different growth conditions

  • Fluxomics: Metabolic flux analysis of cell wall biosynthesis pathways

Structural and Functional Studies:

  • Structural biology: Determination of S. pomeroyi uppP structure through X-ray crystallography or cryo-EM

  • Molecular dynamics: Simulation of uppP function in different membrane environments

  • Enzyme kinetics: Detailed mechanistic studies under marine-relevant conditions

Ecological Context:

  • Field studies: Analysis of uppP expression in natural marine populations

  • Mesocosm experiments: Controlled studies of S. pomeroyi in simulated ocean environments

  • Metagenomics: Assessment of uppP diversity in marine microbial communities

Technological Innovations:

  • Single-cell analysis: Examination of uppP expression heterogeneity

  • In situ visualization: Development of methods to observe uppP localization in native conditions

  • Microfluidics: Creation of systems to mimic microenvironments experienced by marine bacteria

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.