Recombinant Silicibacter sp. ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Silicibacter sp. ATP synthase subunit b/b' (atpG) corresponds to a specific component of the ATP synthase complex derived from the bacterium Silicibacter sp. ATP synthase, or F-ATPase, is an essential enzyme that produces adenosine triphosphate (ATP), the primary energy currency in living organisms . The subunit b/b' (atpG) is a crucial part of the F0 sector of the ATP synthase, which is embedded in the cell membrane and responsible for proton translocation .

Function and Structure

The ATP synthase enzyme comprises two main functional units: F0 and F1. The F0 sector acts as a proton channel, driven by the proton-motive force across the membrane. This force powers the rotation of the F0 sector, which in turn drives the synthesis of ATP in the F1 sector. The subunit b/b' is a key structural component of the F0 sector, essential for its assembly, stability, and function . In Clostridium acetobutylicum, disruption of the atpG gene, which encodes the ATPase gamma subunit, impacts ATP metabolism .

Role in Bacteria

In heterotrophic bacteria such as Sulfitobacter mediterraneus and Planococcus maritimus, ATP levels vary significantly depending on environmental conditions, such as the hydrophobicity of the surface to which they attach . High-resolution atomic force microscopy has revealed a correlation between the porous cell-surface of certain a- and g-proteobacteria and their ability to secrete high amounts of ATP .

Implications for Drug Development

The ATP synthase enzyme is a target for developing new antibacterial drugs . For example, bedaquiline (BD) is an anti-tuberculosis drug that inhibits ATP synthase in Mycobacterium tuberculosis . The unique structural features of mycobacterial ATP synthase, which are not present in the human enzyme, can be exploited for the development of new anti-TB drugs .

ATP Synthase Subunit b'(atpG) ELISA Recombinant Protein

ELISA Recombinant Rhodobacter sphaeroides ATP synthase subunit b'(atpG) is a recombinant protein with the following features :

  • Source: Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

  • UniProt: Q3IZ14

  • Tag: The tag type is determined during production .

  • Storage: Tris-based buffer, 50% glycerol

  • Sequence Length: 1-180 amino acids

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; TM1040_2592; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Ruegeria sp. (strain TM1040) (Silicibacter sp.)
Target Names
atpF2
Target Protein Sequence
MATTTHDAGHGAAEAAHGSSGMPQLDFSTYGNQIFWLLVTLVVIYLILSRIALPRIAAIL NERQGTITNDLAAAEDLKAKAVEAENAYNKALADARAEAQRIAAETRAEIQAEVDEAIAK ADAEISAKAAESEKAIAEIRAGALESVKVVAADTASALVAALGGKDDADAVKAAVAERTE G
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b'-subunit, a divergent and duplicated form of the b subunit found in plants and photosynthetic bacteria, is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of ATP synthase subunit b/b' (atpG) in Silicibacter sp.?

The ATP synthase subunit b/b' (atpG) in Silicibacter sp. forms part of the peripheral stalk (stator) that connects the F1 (catalytic) and F0 (membrane-embedded) domains of the ATP synthase complex. This stator structure prevents the F1 domain from rotating with the central rotor during ATP synthesis, allowing the mechanical energy from proton translocation to be converted into chemical energy in the form of ATP.

In Silicibacter sp., which belongs to the marine Roseobacter clade of Alphaproteobacteria, the ATP synthase complex is particularly important for energy production during various growth conditions, including during symbiotic relationships with marine dinoflagellates . The atpG subunit's role in maintaining the structural integrity of the ATP synthase complex is essential for ensuring efficient energy conversion during oxidative phosphorylation, which powers cellular processes.

What experimental approaches are used to express recombinant Silicibacter sp. ATP synthase subunit b/b'?

Expression of recombinant Silicibacter sp. ATP synthase subunit b/b' (atpG) requires careful consideration of expression systems and conditions to ensure proper folding and functionality. The following experimental methodology is recommended based on approaches used for similar ATP synthase subunits:

  • Gene cloning and vector selection:

    • Amplify the atpG gene from Silicibacter sp. genomic DNA using high-fidelity PCR

    • Design primers with appropriate restriction sites for directional cloning

    • Clone into expression vectors with different promoter strengths (e.g., T7, tac, arabinose-inducible)

    • Include purification tags (His6, GST, MBP) preferably at the N-terminus to minimize interference with function

  • Expression host selection:

    • E. coli BL21(DE3) for high-level expression

    • E. coli C43(DE3) or C41(DE3) for membrane proteins and proteins toxic to standard strains

    • Cell-free expression systems for difficult-to-express proteins

  • Optimization of expression conditions:

    • Test multiple induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Vary inducer concentrations

    • Test different media formulations (LB, TB, auto-induction media)

    • Optimize expression time (4h to overnight)

Similar approaches have been successfully employed for other ATP synthase components, such as in the studies of mycobacterial ATP synthase, where researchers developed systems to express and study the function of ATP synthase components in both whole cells and reconstituted systems . By adapting these methods to the specific characteristics of Silicibacter sp. atpG, researchers can obtain sufficient quantities of functional protein for further studies.

How can researchers verify the proper folding and function of recombinant Silicibacter sp. atpG?

Verifying proper folding and function of recombinant Silicibacter sp. ATP synthase subunit b/b' is crucial for ensuring reliable experimental results. Multiple complementary approaches should be employed:

  • Biophysical characterization techniques:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure content

    • Thermal denaturation monitored by CD to assess stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

    • Dynamic light scattering (DLS) to assess monodispersity and detect aggregation

    • Limited proteolysis to probe for properly folded domains versus unstructured regions

  • Functional assays:

    • ATP-driven acidification of inverted membrane vesicles (IMVs) can be used to assess functionality, similar to methods developed for mycobacterial ATP synthase

    • Reconstitution into proteoliposomes for proton pumping assays

    • Complementation of ATP synthase-deficient bacterial strains

  • Interaction studies:

    • Pull-down assays with other ATP synthase subunits to verify binding capability

    • Cross-linking followed by mass spectrometry to identify interaction surfaces

    • Blue native PAGE to assess complex formation with other ATP synthase components

For example, researchers working with mycobacterial ATP synthase have developed assays where ATP-driven acidification of IMVs can be monitored using fluorescence recovery techniques . This methodology could be adapted for Silicibacter sp. atpG to verify its functional incorporation into the ATP synthase complex. Similarly, membrane potential measurements using fluorescent probes, as used in studies of S. aureus ATP synthase , could be applied to assess the impact of recombinant atpG on energy coupling.

What are the challenges in purifying functional recombinant Silicibacter sp. ATP synthase subunit b/b'?

Purifying functional recombinant Silicibacter sp. ATP synthase subunit b/b' presents several technical challenges due to its structural and functional characteristics:

  • Membrane association and hydrophobicity:

    • The N-terminal domain is embedded in the membrane, making solubilization difficult

    • Traditional aqueous buffers are insufficient without proper detergents

    • Over-solubilization can disrupt protein structure and function

  • Structural integrity and protein folding:

    • The elongated coiled-coil structure may not fold properly in heterologous expression systems

    • Improper folding can lead to aggregation and inclusion body formation

    • The native oligomerization state may be difficult to maintain during purification

  • Stability issues:

    • Isolated subunits may be less stable than when integrated in the complete ATP synthase complex

    • Proteolytic degradation can occur, particularly at flexible linker regions

    • Long-term storage may lead to denaturation or aggregation

These challenges are similar to those encountered in studies of ATP synthase components from other bacteria. For example, when working with mycobacterial ATP synthase, researchers needed to develop specialized approaches to maintain the structural integrity of the complex during isolation and reconstitution . Similarly, studies with S. aureus ATP synthase required careful optimization of experimental conditions to preserve functionality .

ChallengeSolution ApproachValidation Method
Membrane solubilizationScreen multiple detergents (DDM, LDAO, OG, Triton X-100)SEC peak homogeneity
Protein stabilityInclude stabilizing agents (glycerol, specific lipids)Thermal shift assays
Proper foldingUse solubility-enhancing tags (MBP, SUMO)Circular dichroism
Complex assemblyCo-expression with interacting subunitsNative PAGE analysis

How does membrane potential influence the function of ATP synthase in Silicibacter sp.?

Membrane potential plays a critical role in the function of ATP synthase in Silicibacter sp., influencing both the enzyme's activity and its contribution to cellular bioenergetics. This relationship can be understood through several key aspects:

  • Bioenergetic coupling:

    • The membrane potential (ΔΨ) component of the proton motive force drives ATP synthesis by the F1F0-ATP synthase

    • Changes in membrane potential directly affect the rate of ATP production

    • ATP synthase activity can itself influence the membrane potential

  • Experimental measurement approaches:

    • Fluorescent probes such as DiOC2(3) can be used to measure bacterial membrane potential

    • Potentiometric dyes like JC-1 provide ratiometric measurement of membrane potential changes

    • Patch-clamp techniques can be used for direct measurement in specialized applications

  • Regulatory significance:

    • Membrane potential changes can serve as signals for modulating ATP synthase expression

    • The "swim-or-stick" behavioral switch in Silicibacter sp. likely involves significant changes in bioenergetics and membrane potential

Studies with S. aureus have demonstrated that ATP synthase inhibitors like Tomatidine (TO) cause a dose-dependent reduction in membrane potential . Similar approaches could be applied to study Silicibacter sp. ATP synthase. Interestingly, even when bacterial strains show high resistance to ATP synthase inhibitors (MIC > 128 μg/ml), their membrane potential can still be significantly reduced by these compounds, indicating complex relationships between ATP synthase activity, membrane potential, and bacterial viability .

For Silicibacter sp., the membrane potential changes associated with ATP synthase activity may be particularly important during the transition between free-swimming and surface-attached lifestyles during symbiosis with dinoflagellates, as this transition requires significant bioenergetic adaptations .

What buffer conditions optimize stability of recombinant Silicibacter sp. ATP synthase subunit b/b'?

Optimizing buffer conditions is critical for maintaining the stability and functionality of recombinant Silicibacter sp. ATP synthase subunit b/b' (atpG). The optimal conditions would reflect the marine environment of Silicibacter sp. and the specific requirements of membrane proteins.

Methodological approach for buffer optimization:

  • Systematic buffer screening:

    • Test buffer types across pH range 6.0-8.5 (PIPES, MES, HEPES, Tris, phosphate)

    • Evaluate salt concentration ranges (50-500 mM NaCl)

    • Include marine-relevant ions (Mg²⁺, Ca²⁺) at various concentrations

    • Test stabilizing additives (glycerol 5-20%, sucrose 5-15%, arginine 50-200 mM)

  • Detergent optimization for membrane domain:

    • Screen detergent types (DDM, LDAO, OG, Triton X-100, CHAPS, digitonin)

    • Test detergent concentrations (1-5× critical micelle concentration)

    • Evaluate detergent:protein ratios for optimal solubilization

    • Consider mixed micelle systems or lipid supplementation

  • Stability assessment methods:

    • Thermal denaturation monitoring using differential scanning fluorimetry

    • Time-course activity retention at various temperatures (4°C, 25°C, 37°C)

    • SEC-MALS to monitor oligomeric state maintenance over time

    • DLS to detect aggregation under various conditions

Based on studies of ATP synthase components, the following buffer conditions may serve as a starting point:

Buffer ComponentConcentration RangeOptimization Notes
Buffer type25-50 mM HEPES or TrispH 7.2-7.8 typically optimal
NaCl100-300 mMHigher for membrane-associated forms
MgCl₂1-5 mMEssential for structural stability
Glycerol5-15%Prevents aggregation
Detergent0.02-0.05% DDMMaintain above CMC
EDTA0.1-1 mMPrevents metal-catalyzed oxidation
DTT or TCEP1-5 mMIf cysteines are present

Similar buffer optimization strategies have been employed for studies of bacterial ATP synthases from other species, such as in the development of assays for mycobacterial ATP synthase activities .

What techniques best assess protein-protein interactions involving Silicibacter sp. ATP synthase subunit b/b'?

Understanding protein-protein interactions involving Silicibacter sp. ATP synthase subunit b/b' (atpG) is crucial for elucidating its role in the ATP synthase complex and potentially in other cellular processes. Multiple complementary techniques should be employed:

  • Co-immunoprecipitation and pull-down assays:

    • Express recombinant atpG with affinity tags (His, FLAG, GST)

    • Prepare Silicibacter sp. cell lysates under non-denaturing conditions

    • Perform pull-downs to identify interacting partners

    • Confirm interactions using reciprocal pull-downs

    • Analyze captured proteins by mass spectrometry

  • Cross-linking coupled with mass spectrometry (XL-MS):

    • Use chemical cross-linkers of varying lengths (DSS, BS3, EDC)

    • Apply in vitro to purified components or in vivo in Silicibacter cells

    • Digest cross-linked complexes and analyze by LC-MS/MS

    • Identify cross-linked peptides using specialized software

    • Map interaction interfaces on structural models

  • Surface plasmon resonance (SPR) and bio-layer interferometry (BLI):

    • Immobilize purified atpG on sensor chips or tips

    • Flow potential interaction partners at varying concentrations

    • Determine binding kinetics (kon, koff) and affinity (KD)

  • Förster resonance energy transfer (FRET):

    • Create fluorescent protein fusions with atpG and potential partners

    • Express in heterologous systems or native Silicibacter

    • Measure energy transfer as indication of protein proximity

For ATP synthase complex assembly, special attention should be given to interactions between atpG and other stator components, as well as with the F1 domain components where the peripheral stalk connects. Studies with mycobacterial ATP synthase have shown the importance of understanding these interactions for developing assays that can assess ATP synthase function and inhibition .

How can researchers develop functional assays specific to Silicibacter sp. ATP synthase activity?

Developing functional assays specific to Silicibacter sp. ATP synthase activity requires adaptation of existing techniques used for other bacterial ATP synthases, with particular consideration for the unique properties of marine bacterial proteins:

  • Inverted membrane vesicle (IMV) assays:

    • Prepare IMVs from Silicibacter sp. cells through mechanical disruption and differential centrifugation

    • Monitor ATP-driven acidification using pH-sensitive fluorescent dyes

    • Measure ATP hydrolysis through phosphate release assays

    • Assess the effects of specific inhibitors on ATP synthase activity

This approach is similar to methods developed for mycobacterial ATP synthase, where researchers used IMVs to measure both ATP synthesis and ATP-driven proton pumping . The key adaptation for Silicibacter sp. would involve optimizing membrane preparation protocols for marine bacterial cells.

  • Reconstitution in proteoliposomes:

    • Purify individual ATP synthase components or subcomplexes

    • Reconstitute proteins into liposomes of defined composition

    • Measure ATP synthesis driven by artificially imposed proton gradients

    • Assess proton pumping driven by ATP hydrolysis

  • Membrane potential and ROS measurement:

    • Use fluorescent probes to measure membrane potential changes in intact cells

    • Assess the relationship between ATP synthase activity and reactive oxygen species (ROS) production

    • Correlate ATP synthase activity with cellular bioenergetic parameters

Studies with S. aureus have shown that inhibition of ATP synthase can lead to changes in membrane potential and ROS production . Similar approaches could be adapted for Silicibacter sp., with consideration for its unique environmental adaptations.

  • Engineered reporter systems:

    • Create gene fusions between ATP synthase components and reporter proteins

    • Develop in vivo assays for ATP synthase assembly and function

    • Design high-throughput screening systems for ATP synthase modulators

For each assay type, appropriate controls are essential:

  • Known ATP synthase inhibitors (oligomycin, DCCD) as positive controls

  • ATP synthase-deficient mutants as negative controls

  • Comparison with established model systems (E. coli, B. subtilis)

How do mutations in the atpG gene affect ATP synthesis and symbiotic relationships in Silicibacter sp.?

Methodological approach for mutation studies:

  • Site-directed mutagenesis strategy:

    • Identify conserved residues through multiple sequence alignment

    • Target residues at predicted interaction interfaces

    • Create charge reversal mutations in coiled-coil regions

    • Introduce mutations in the membrane-anchoring domain

    • Design truncations to identify essential regions

  • Expression and functional reconstitution:

    • Express wild-type and mutant proteins in suitable systems

    • Purify and reconstitute into proteoliposomes

    • Assess ATP synthesis activity under various conditions

    • Measure proton translocation efficiency

    • Determine impacts on complex assembly

  • In vivo mutational analysis:

    • Create knockout strains complemented with mutant variants

    • Assess growth phenotypes under different conditions

    • Measure cellular ATP levels and membrane potential

    • Analyze impact on symbiotic relationships with dinoflagellates

    • Evaluate stress responses and adaptation mechanisms

The symbiotic relationship between Silicibacter sp. and dinoflagellates involves a "swim-or-stick" behavioral switch that requires significant changes in the bacterium's physiology . Mutations in atpG could potentially disrupt this transition by affecting energy production during critical phases of the symbiotic process. Studies with S. aureus have shown that mutations in ATP synthase components can significantly affect bacterial fitness and virulence , suggesting that similar effects might be observed in the symbiotic capabilities of Silicibacter sp.

Expected functional consequences of mutations:

Mutation RegionPredicted EffectFunctional ImpactSymbiosis Effect
Membrane anchorAltered membrane associationReduced complex stabilityImpaired attachment
Coiled-coil domainDisrupted dimerizationDecreased stator rigidityEnergy deficiency during transition
C-terminal domainImpaired F1 interactionUncoupled ATP synthesisReduced biofilm formation
Conserved charged residuesDisrupted ionic interactionsStructural instabilityCompromised adaptation to host

What role does ATP synthase play in the bioenergetics of Silicibacter sp. during symbiosis with marine dinoflagellates?

The ATP synthase complex plays a critical role in the bioenergetics of Silicibacter sp. during its symbiotic relationship with marine dinoflagellates. Understanding this role requires investigating the connection between ATP synthase function and the physiological adaptations that occur during symbiosis.

Methodological approach to investigate this relationship:

  • Comparative bioenergetics analysis:

    • Measure ATP production rates in free-living vs. symbiotic states

    • Quantify membrane potential in different growth conditions

    • Determine oxygen consumption rates during symbiosis

    • Assess proton motive force components (ΔpH and ΔΨ) in both states

    • Compare ATP synthase activity in isolated membranes from both conditions

  • Gene expression and protein analysis:

    • Perform RNA-Seq to quantify atpG expression changes during symbiosis

    • Use quantitative proteomics to measure ATP synthase subunit stoichiometry

    • Employ ribosome profiling to assess translation efficiency of ATP synthase genes

    • Use reporter fusions to monitor atpG promoter activity during symbiotic stages

  • Metabolic adaptation studies:

    • Use metabolomics to identify changes in energy-related metabolites

    • Track carbon flux through central metabolism in symbiotic state

    • Measure NAD+/NADH and ATP/ADP ratios during symbiotic stages

    • Determine if alternative energy generation pathways are activated

The "swim-or-stick" behavioral switch mentioned in research on Silicibacter sp. TM1040 likely involves significant bioenergetic reprogramming, with ATP synthase playing a central role in adjusting energy production during the transition from motile to biofilm states . Similar to observations in S. aureus, where membrane potential is significantly affected by ATP synthase inhibition , the symbiotic state of Silicibacter sp. may involve regulated changes in membrane energetics to support different physiological demands.

Expected findings might include:

  • Altered atpG expression during different phases of symbiosis

  • Changes in ATP synthase efficiency during the transition from swimming to attachment

  • Correlation between ATP production capacity and biofilm formation ability

  • Specific adaptations of the ATP synthase complex to function optimally in the microenvironment created at the dinoflagellate surface

How can inhibitors targeting Silicibacter sp. ATP synthase be developed for research applications?

Developing specific inhibitors targeting Silicibacter sp. ATP synthase subunit b/b' (atpG) requires a structured approach combining computational, biochemical, and microbiological methods. This approach would aim to identify molecules that selectively interact with atpG for use as research tools.

Methodological framework for inhibitor development:

  • Target site identification and validation:

    • Perform structural analysis to identify potential binding pockets

    • Focus on regions unique to Silicibacter sp. or marine bacteria

    • Use alanine scanning mutagenesis to validate functional importance

    • Conduct molecular dynamics simulations to identify dynamic binding sites

  • In silico screening approach:

    • Develop pharmacophore models based on structural information

    • Perform virtual screening of compound libraries

    • Use molecular docking to predict binding modes and affinities

    • Apply molecular dynamics to assess stability of ligand-protein complexes

  • Biochemical screening and validation:

    • Develop high-throughput assays specific for atpG function

    • Screen compound libraries using purified proteins or membrane vesicles

    • Measure effects on ATP synthesis in reconstituted systems

    • Determine binding kinetics using SPR or isothermal titration calorimetry

  • Functional validation in relevant systems:

    • Test effects on Silicibacter sp. growth and survival

    • Assess impact on symbiotic relationships with dinoflagellates

    • Evaluate effects on biofilm formation capabilities

    • Measure changes in cellular bioenergetics

The approach would draw on knowledge from existing ATP synthase inhibitors, such as those described for mycobacterial ATP synthase and for S. aureus ATP synthase , adapting strategies to the unique features of Silicibacter sp. atpG.

Studies with S. aureus have shown that the ATP synthase inhibitor Tomatidine (TO) causes a dose-dependent reduction in membrane potential and can significantly affect bacterial physiology even at concentrations below the MIC . Similar approaches could be applied to develop research tools for studying Silicibacter sp. ATP synthase function in various contexts, including during symbiotic relationships with dinoflagellates.

What structural adaptations in ATP synthase subunit b/b' are specific to marine bacteria like Silicibacter sp.?

The structural adaptations in ATP synthase subunit b/b' found in marine bacteria like Silicibacter sp. reflect evolutionary responses to their unique environmental conditions, particularly related to salinity, pressure, and temperature conditions. Understanding these adaptations provides insights into the molecular basis of environmental specialization.

Methodological approach to investigate structural adaptations:

  • Comparative sequence and structural analysis:

    • Collect atpG sequences from diverse marine and terrestrial bacteria

    • Perform multiple sequence alignments to identify conserved and variable regions

    • Calculate conservation scores and map onto structural models

    • Identify marine-specific sequence motifs or residue preferences

    • Compare hydropathy profiles between marine and terrestrial homologs

  • Amino acid composition analysis:

    • Quantify amino acid frequencies in marine versus terrestrial b/b' sequences

    • Analyze charged residue distribution patterns

    • Compare salt bridge and hydrogen bonding potential

    • Assess surface-exposed versus core residue differences

  • Structural modeling and simulation:

    • Generate homology models of marine and terrestrial b/b' subunits

    • Perform molecular dynamics simulations under varying salt concentrations

    • Apply pressure simulations to mimic deep sea conditions where applicable

    • Calculate structural stability parameters under different conditions

Expected structural adaptations in marine bacterial ATP synthase subunit b/b':

Structural FeatureMarine AdaptationFunctional ConsequenceDetection Method
Surface charge distributionIncreased negative chargeEnhanced stability in high saltElectrostatic surface mapping
Hydrophobic coreMore flexible packingFunction at lower temperaturesCore residue analysis, MD simulation
Coiled-coil domainModified heptad repeat patternsAltered stator rigidityCoiled-coil prediction algorithms
Ion pair networksIncreased ion pairsResistance to pressure effectsStructure analysis, salt bridge counting
Membrane anchorAltered hydrophobicity profileAdaptation to different membrane compositionTMHMM analysis, hydropathy plots

These adaptations would reflect the ecological niche of Silicibacter sp. and other marine Roseobacter clade bacteria, potentially contributing to their success in forming symbiotic relationships with marine dinoflagellates as described in research on Silicibacter sp. TM1040 .

How is the expression of atpG regulated during different phases of Silicibacter sp. growth and symbiosis?

Understanding how the expression of the atpG gene is regulated in Silicibacter sp. provides insights into the adaptive strategies of this marine bacterium, particularly during its symbiotic relationship with dinoflagellates. This regulation occurs at multiple levels and responds to various environmental cues.

Methodological approach to investigate regulatory mechanisms:

  • Transcriptional regulation analysis:

    • Identify promoter elements and potential regulatory binding sites

    • Perform chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors

    • Use reporter fusions (GFP, luciferase) to monitor promoter activity

    • Apply RNA-seq across growth phases and symbiotic states

    • Perform transcription start site mapping to identify alternative promoters

  • Environmental condition testing:

    • Simulate relevant marine conditions in laboratory settings:

      • Temperature ranges (4-30°C)

      • Salinity gradients (15-40 ppt)

      • Oxygen levels (aerobic, microaerobic, anaerobic zones)

      • Nutrient availability (carbon, nitrogen, phosphorus limitation)

      • Presence of dinoflagellate exudates or co-culture conditions

  • Post-transcriptional and post-translational regulation:

    • Analyze mRNA stability under different conditions

    • Identify potential small RNAs regulating atpG expression

    • Detect post-translational modifications affecting protein function

    • Assess protein turnover rates in different growth phases

Since Silicibacter sp. undergoes a significant behavioral and physiological transition during the "swim-or-stick" switch when establishing symbiosis with dinoflagellates , the regulation of energy metabolism genes like atpG would likely be coordinated with this transition. The timing and pattern of atpG expression may reflect the changing energy demands associated with motility, chemotaxis, biofilm formation, and adaptation to the host microenvironment.

Expected regulatory patterns:

Growth PhasePredicted RegulationPhysiological RationaleDetection Method
Exponential growthHigh expressionMaximal energy productionqRT-PCR, proteomics
Early symbiosisTransient upregulationEnergy for attachmentTime-course RNA-seq
Biofilm formationModified regulationAdaptation to sessile lifestyleBiofilm vs. planktonic comparisons
Mature symbiosisStabilized expressionOptimized energy productionCo-culture long-term studies

These regulatory patterns would parallel aspects of the regulation observed for other bacterial ATP synthases, such as in S. aureus, where energy metabolism undergoes significant changes during different growth conditions and in response to stressors .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.